DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6996 and obst-F

DIOPT Version :9

Sequence 1:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster


Alignment Length:253 Identity:56/253 - (22%)
Similarity:82/253 - (32%) Gaps:93/253 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 DGVFVKDTDNCNGYQLCWDGQVINGTCPGTFY------FKASTAQCDYPQNVECDFVPVPDISKK 209
            :|..|....:||||..|       ...|...|      |..:.|.||.|:|..|..|....:   
  Fly    48 EGDLVPHPLDCNGYFSC-------SRVPTLLYCDQGLQFDENRAICDLPENTNCRPVATGTV--- 102

  Fly   210 GVCPETGGFISDNKTCNGY-------YYCKDLGNGE-------FSLEHGVCSD-GRFFLATDGGA 259
                |:...::||...|.:       :...|:.:|:       :..||..|.. |.:||..    
  Fly   103 ----ESANGLADNSELNWWPHKPKPVFVAVDVTSGQPVNPMEKYDPEHIECRHYGAYFLPH---- 159

  Fly   260 CVPRSKVKCGYDRCVGLGNSTIQLANESDDGCRGYSICQDGIV----IGQGTCPQDEYFDEITQR 320
              ||:   ||.                       |.||..|.:    .|:||...   |::...:
  Fly   160 --PRN---CGL-----------------------YFICAYGHLHRHQCGRGTAWN---FEKSECQ 193

  Fly   321 CTTQVISYTACQISE----ATTGSQVPSGTT---------------TTTSSTITSTTI 359
            .:.|.|.|...||||    ..|..:||:..:               ||....:||..|
  Fly   194 LSDQAICYGESQISEPHTDVETTMKVPTANSEGAVTVCYIVGSSEYTTLQQFLTSPEI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884
ChtBD2 85..130 CDD:214696
CBM_14 146..196 CDD:279884 14/50 (28%)
CBM_14 273..322 CDD:279884 8/52 (15%)
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 15/52 (29%)
CBM_14 156..198 CDD:279884 14/76 (18%)
CBM_14 272..321 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444033
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.