DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6996 and obst-H

DIOPT Version :9

Sequence 1:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster


Alignment Length:251 Identity:64/251 - (25%)
Similarity:84/251 - (33%) Gaps:63/251 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LSSSSIKCLSSDPCAALPTG-FAADPYSCNGYYYCKDGKGTHGVCNTGMNFNS--GTQDCIRDFP 135
            |.||.|.....|.|..:..| |.....||..|.||:..:...|.|..|..|:|  ||.|...:..
  Fly    13 LWSSRINADHFDECDGMDDGAFVQSWESCQSYVYCEGEESLKGDCEDGEYFDSEAGTCDIAANVS 77

  Fly   136 C-----SNKMDPD----------------------------SYCNILP-------------DGVF 154
            |     ....||:                            ...||.|             ..:|
  Fly    78 CFLDEVDEPSDPEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAPVVRPNCPISDDPGQVIF 142

  Fly   155 VKDTDNCNGYQLCWDGQVINGTCPGTFYFKASTAQCDYPQNVECDFVPVPDISKKGVCPETGGFI 219
            :...::|..|.||:.|..:...|....||.:.|.|||||..|:|.|   .|.......|....|.
  Fly   143 MASNNSCTNYYLCYHGHAMEMHCDNELYFNSLTGQCDYPDKVQCAF---EDPRSHKCLPHMTEFF 204

  Fly   220 SDNKTCNGYYYCKDLGNGEFSLEHGVCSDGRFFLATDGGACVPRSKVKCGYDRCVG 275
            .....||.:|||.   .|..:|:.  |.   |:...|   ...||.|:.|..:|.|
  Fly   205 PHPDNCNYFYYCI---KGFLTLQQ--CP---FYYGWD---IERRSCVQIGVAKCYG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884
ChtBD2 85..130 CDD:214696 16/47 (34%)
CBM_14 146..196 CDD:279884 18/62 (29%)
CBM_14 273..322 CDD:279884 2/3 (67%)
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 16/50 (32%)
CBM_14 142..184 CDD:279884 15/41 (37%)
ChtBD2 203..240 CDD:214696 13/47 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.