DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6996 and CG10140

DIOPT Version :9

Sequence 1:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster


Alignment Length:256 Identity:66/256 - (25%)
Similarity:99/256 - (38%) Gaps:41/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GALTFNATLICSLVVNGTKMNDPRACNAWIQCIDGSPVSGSCATGLFYDRESQKCLSSSSIKCLS 83
            |.:|.|.: ||..|.:...:.....||.:..|..|..:...|.....::..:|.|:......||.
  Fly    46 GLITGNLS-ICGNVADNVFLPFVGDCNRYYLCRSGQAIELQCEWPYEFNANTQSCVHPGDADCLP 109

  Fly    84 SDPCAALPTGFAADPY--SCNGYYYCKDGKGTHGVCNTGMNFNSGTQDCIRDFPCSNKMDPDSYC 146
            :  |.|.  .|:...|  :|..|..|..||.....|..|:.:||.|..|  ||| .|....:|.|
  Fly   110 T--CEAF--NFSTFSYQRTCTRYVLCYYGKPVLRQCQDGLQYNSATDRC--DFP-QNVDCVESEC 167

  Fly   147 NILPDGV---FVKDTDNCNGYQLCWDGQVINGTCPGTFYFKASTAQCDYPQNVECDFVPVPDISK 208
            :|..:..   :|....:|..|.:|.:|.....||....:|......||.|...:|.   :|.:.:
  Fly   168 SIYSNAYHLRYVPSKVSCQKYFICGNGIPREQTCTAGLHFSTKCDCCDIPSKSDCQ---IPAVER 229

  Fly   209 K-------------GVCPETG-GFISDNKTCNGYYYCKDLGNGEFSLEHGV---CSDGRFF 252
            |             |:||.:| .|.......:.||||.|        .||:   ||.|.::
  Fly   230 KVQQLSRLSPVTTVGICPPSGVHFYVHESRRDAYYYCVD--------GHGLVLDCSAGLWY 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884 8/43 (19%)
ChtBD2 85..130 CDD:214696 14/46 (30%)
CBM_14 146..196 CDD:279884 13/52 (25%)
CBM_14 273..322 CDD:279884
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 7/42 (17%)
CBM_14 111..161 CDD:279884 19/54 (35%)
CBM_14 178..222 CDD:279884 11/43 (26%)
CBM_14 246..295 CDD:279884 14/45 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.