DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6996 and CG11570

DIOPT Version :9

Sequence 1:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001356902.1 Gene:CG11570 / 39357 FlyBaseID:FBgn0036230 Length:262 Species:Drosophila melanogaster


Alignment Length:247 Identity:44/247 - (17%)
Similarity:68/247 - (27%) Gaps:90/247 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 CNTGMNFNSGTQDCIRDFPCSNKMDPDSYCNILPDGVFVKDTDNCNGYQLCWDGQVINGTCPGTF 181
            |....|..|...|  ....|....||:       ..|.:...::|:.|.:|..|:.....||...
  Fly    21 CQENNNLVSIVTD--HSIQCPPFDDPN-------HNVMLPYPNDCSKYYVCQKGRAYEQQCPLNL 76

  Fly   182 YFKASTAQCDYPQNVECD-FVPVPDISKKGVCPETGGFISDNKTCNGYYYCKDLGNGEFSLEHGV 245
            ::...|.:|||.:...|: ::|.|:...:.:                           ||...|.
  Fly    77 FWSQMTYRCDYKEYSNCNTYIPSPNHDVEVI---------------------------FSAYPGD 114

  Fly   246 CSDGRFFLATDGGACVPRSKVKCGYDRCVGLGNSTIQLANESDDGCRGYSICQDGIVIGQGTCPQ 310
            |.  ||:                                             :..|:    .|.|
  Fly   115 CR--RFY---------------------------------------------ETRIL----RCEQ 128

  Fly   311 DEYFDEITQRCTTQVISYTACQISEATTGSQVPSGTTTTTSSTITSTTIAVP 362
            :..:..:.|||.  |..|..||.|..|....||.....|.....|.....:|
  Fly   129 NLQWSSVYQRCV--VPQYGDCQNSPVTVPPVVPFTPLPTYPPVPTVPATVIP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884
ChtBD2 85..130 CDD:214696 3/12 (25%)
CBM_14 146..196 CDD:279884 11/49 (22%)
CBM_14 273..322 CDD:279884 5/48 (10%)
CG11570NP_001356902.1 CBM_14 51..93 CDD:307643 10/41 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.