DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6996 and CG13312

DIOPT Version :9

Sequence 1:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster


Alignment Length:205 Identity:50/205 - (24%)
Similarity:80/205 - (39%) Gaps:59/205 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ICSLVVNGTKMNDPRACNAWIQCIDGSPVSGSCATGLFYDRESQKCLSSSSIKCLSSDP------ 86
            :|::       ||.:.|        |.|..|...|..:.|..:...:||::....::.|      
  Fly   132 VCNI-------NDTQIC--------GLPADGVMPTCSYSDDSTTTTVSSTTSSTTAAPPSTSSAS 181

  Fly    87 --CAALPT-GFAADPY----SCNGYYYCK--DGK--GTHGVCNTGMNFNSGTQDCIRDFP--CS- 137
              |||:.: |..|..|    :|..|.||.  ||.  |....|...|.|:|.::.|:...|  || 
  Fly   182 TYCAAVQSQGKYAVGYNAYTTCRQYIYCTLVDGSWIGQTYTCPGSMYFDSASEMCVSTMPSTCST 246

  Fly   138 ------------NKMDPDSYCNILPD-GVFVKDTD---NCNGYQLC------WDGQVINGTCPGT 180
                        ...:|::||..:.. |.:...||   .|:.|..|      |.|.:.  ||||:
  Fly   247 TATTSSTTTAAPTTSNPEAYCQAMQSAGYYPVGTDASTTCHQYIDCFLNGGTWGGNMY--TCPGS 309

  Fly   181 FYFKASTAQC 190
            .|:.:::..|
  Fly   310 LYYNSASRTC 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884 9/43 (21%)
ChtBD2 85..130 CDD:214696 18/61 (30%)
CBM_14 146..196 CDD:279884 15/55 (27%)
CBM_14 273..322 CDD:279884
CG13312NP_648260.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.