DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6996 and CG33985

DIOPT Version :9

Sequence 1:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster


Alignment Length:301 Identity:59/301 - (19%)
Similarity:104/301 - (34%) Gaps:88/301 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GALTFNATLICSLVV---------------NGTKMNDPRACNAWIQCIDGSPVSGSCATGLFYDR 68
            |.|.|.:.|:..|.:               |.:.:..|::|..:|.|.......|.|..|.::.:
  Fly     3 GVLKFGSILVSLLFLATSHADVFDECNDGNNLSFVTSPKSCAHYIFCNGDESYDGECEDGEYFSQ 67

  Fly    69 ESQKCLSSSSIKCLSSDPCAALPTGFAADPYSCNGYYYCKDGKGTH------------------- 114
            :.:.|.....|.|.:........|               .|...|.                   
  Fly    68 DMEMCEPMGDIDCRTGSEVQRENT---------------TDSSSTEITSESSTISTVVITTLAPS 117

  Fly   115 -------GVCNTGMNFNSGTQDCIRDFPCSN---KMDPDSYCNILPDGVFVKDTDNCNGYQLCWD 169
                   .|..:|.:..:.....| :...:|   ::|..|...:||      :.::|:.|.:|:.
  Fly   118 AVVTLRPSVNQSGASSTTSVSPAI-EIIVTNVCPQLDNQSRIALLP------NQNSCSDYYICYR 175

  Fly   170 GQVINGTCPGTFYFKASTAQCDYPQNVEC---DFVPVPDISKK--GVCPETGGFISDNKTCNGYY 229
            |..:..:|..:.:|.:.|.:||:|:||.|   .:.|.....:.  .|.|.     |||  ||.:|
  Fly   176 GVALPMSCATSLHFNSLTGKCDHPENVRCLAMTYNPREQCKRHVIDVYPH-----SDN--CNYFY 233

  Fly   230 YCKDLGNGEFSLEHGVCSDGRFFLATD--GGACVPRSKVKC 268
            .|:   :|...::.  |.   ||...|  ..:||...:.||
  Fly   234 QCR---SGYLMVQQ--CP---FFYGWDYEKRSCVALGQAKC 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884 9/58 (16%)
ChtBD2 85..130 CDD:214696 5/70 (7%)
CBM_14 146..196 CDD:279884 12/49 (24%)
CBM_14 273..322 CDD:279884
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 9/45 (20%)
CBM_14 160..202 CDD:279884 12/47 (26%)
ChtBD2 215..259 CDD:214696 14/58 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.