DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6996 and CG4835

DIOPT Version :9

Sequence 1:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster


Alignment Length:568 Identity:111/568 - (19%)
Similarity:150/568 - (26%) Gaps:273/568 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PRACNAWIQCIDGSPVSGSCATGLFYDRESQKCLSSSSIKC------------------------ 81
            |..|.|:|.|..|.||...|.....:::....|.:.....|                        
  Fly   197 PYDCQAYINCTYGWPVLNYCIEDKVFNKYLGICDTPDMADCEELPLPTTTTEMPPTSTTEEDVVC 261

  Fly    82 ------LSSDPCAALPTGFAADPYSCNGYYYCKDGKGTHGVCNTGMNFNS-----GTQDCIR--- 132
                  :..|.|.....||...||:|:||..||:|......|.....||:     .|.|.:|   
  Fly   262 GPTPEGIEEDYCVPKGNGFYEYPYNCSGYLACKNGCTDLDYCQPDKLFNNWLHICDTPDSVRCDP 326

  Fly   133 -DFP----CSNK-------------------------------------------------MDPD 143
             .||    .:||                                                 :||:
  Fly   327 LPFPTTPGTTNKPTTPSVTTTPSITTTPSTPTTLPSDGSTTEIHSSTTEEIVTTTDGLPSDVDPN 391

  Fly   144 SYCNILPDGVFVKDTDNCNGYQLCWDGQVINGTCPGTFYFKASTAQCDYPQNVEC----DFVPVP 204
            . |....||.......||:.|.:|.|.||..|.||....|......||.|.:|.|    ...|:|
  Fly   392 D-CKDEKDGTIFAYIGNCSEYLICKDNQVQMGHCPPNTLFNPDLLVCDEPDDVVCLGDRTTTPIP 455

  Fly   205 ----------------------DISKKGVC--PETGGFISDNKTCNGYYYCKDLGNGEFSLEHGV 245
                                  .:....:|  .|.|...|....|:.||.|  ||.|:::|  ..
  Fly   456 TTIPTTTTEKTTPTTTTTTVATTLGPDQLCDGQELGASFSYPDDCSKYYLC--LGGGQWTL--AP 516

  Fly   246 CSDGRFFLATDG--------GACVPRSKVK----------------------------------- 267
            |..|.:|..:.|        .||.| |:|.                                   
  Fly   517 CIYGSYFDPSTGQCGPDVAPDACKP-SQVTTTTTTTTTETTTTERNTTPKSTATTTERTTTTVAP 580

  Fly   268 ----CG----------------YDRCVGLGNSTIQLA--------------------NESD---- 288
                ||                |..||    |.|.:|                    :|||    
  Fly   581 KTGICGGRNENENIAYPNNCTKYIVCV----SPIPIAFFCPDGTFFSSKLEKCIDDWDESDCEGD 641

  Fly   289 -------------------------------DGCRGYSICQDGIVIGQGTCPQDEYFDEITQRCT 322
                                           |.|:.:..|.|..:.....|...||:|.||::| 
  Fly   642 QSTTTLEPGYTRPPPEPTMCTNSSRDTFPYPDNCQWFIRCVDDYIYMMDVCNCGEYYDPITEKC- 705

  Fly   323 TQVISYTACQISEATTGSQVPS--------GTTTTTSSTITSTTIAVP 362
                            |:.|||        .||:|||...|:|.:..|
  Fly   706 ----------------GADVPSDACRWDYTSTTSTTSEPTTTTAVTRP 737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884 9/31 (29%)
ChtBD2 85..130 CDD:214696 16/49 (33%)
CBM_14 146..196 CDD:279884 17/49 (35%)
CBM_14 273..322 CDD:279884 18/103 (17%)
CG4835NP_647965.3 CBM_14 51..103 CDD:279884
CBM_14 185..237 CDD:279884 10/39 (26%)
CBM_14 273..322 CDD:279884 16/48 (33%)
CBM_14 393..444 CDD:279884 17/50 (34%)
CBM_14 485..539 CDD:279884 16/57 (28%)
CBM_14 585..638 CDD:279884 10/56 (18%)
CBM_14 661..714 CDD:279884 15/69 (22%)
CBM_14 744..796 CDD:279884
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444063
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.