DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6996 and obst-E

DIOPT Version :9

Sequence 1:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster


Alignment Length:236 Identity:50/236 - (21%)
Similarity:76/236 - (32%) Gaps:78/236 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ATLICSLVVNGTKMNDPRA------------CNAWIQCIDGSPVSGSCATGLFYDRESQKCLSSS 77
            :.|:|..:.....:..|..            |:::.:|.||:||...|..||.:.:.::      
  Fly     7 SALLCVAMFGSMALGSPECPTPNGRFASGDQCDSYTECQDGTPVEKLCPDGLLFHQRTK------ 65

  Fly    78 SIKCLSSDPCAALPTGFAADPYSCNGYYYCKDGKGTHGVCNTGMNFNSGTQDCIRDFPCSNKMDP 142
                 ::..|...|            |..||:        ...:...:||::|.|.|        
  Fly    66 -----ATGECTYAP------------YSTCKE--------RARLQPANGTEECPRQF-------- 97

  Fly   143 DSYCNILPDGVFVKDTDNCNGYQLCWDGQVINGTCPGTFYFKASTAQCDYPQNVE---------- 197
                ...|:|    |...|..|:.|..|......||....|...|.|||:|..||          
  Fly    98 ----GFYPNG----DATKCGVYRNCAHGVASLTKCPEGLAFNEETYQCDWPDLVESCNAEAYLGF 154

  Fly   198 -CDFVPVPDISKKG---VCPETGG---FISDNKTCNGYYYC 231
             |......|.|...   |.||  |   :....:||..|:.|
  Fly   155 NCPAADSADDSAAAAVDVSPE--GELRYYRHPQTCKKYFVC 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884 11/55 (20%)
ChtBD2 85..130 CDD:214696 7/44 (16%)
CBM_14 146..196 CDD:279884 15/49 (31%)
CBM_14 273..322 CDD:279884
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 10/41 (24%)
CBM_14 95..146 CDD:307643 19/66 (29%)
CBM_14 180..225 CDD:307643 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.