DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6996 and AgaP_AGAP002629

DIOPT Version :9

Sequence 1:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_563520.4 Gene:AgaP_AGAP002629 / 3290656 VectorBaseID:AGAP002629 Length:749 Species:Anopheles gambiae


Alignment Length:235 Identity:57/235 - (24%)
Similarity:78/235 - (33%) Gaps:66/235 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 CAALPTGFAADPYSCNGYYYC-KDGKGTHGV---CNTGMNFNSGTQDCIRD--------FPC--- 136
            |.|  .|..|:|..|:.||.| ....|.:.:   |..|..:|...:.|..|        |.|   
Mosquito   527 CPA--AGRFANPTDCHKYYVCFWLPFGLYSLEQNCLAGYAYNPSLERCTADQSVCFPGEFTCMGP 589

  Fly   137 ---SNKMDPDSY--CNILPDGVFVKDTDNCNGYQL-CWDGQVIN---GTCPGTFYFK-------- 184
               .:..||.||  |.....|.:::       |:: |..|||.|   |.|......:        
Mosquito   590 GRFPDPADPTSYFWCVWNMFGGYLQ-------YKMQCPMGQVYNAFRGRCAFAVAGRSLPFDELD 647

  Fly   185 -----ASTAQCDYPQNVECDFVPV--------------PDISKKGVCPETGGFISDNKTCNGYYY 230
                 |..|:..:|..|:....||              |.:..|..|.|.|.| :|...|..|:.
Mosquito   648 DELAAAEVAEESHPAEVDSAVEPVETEVEPVTPVAEEQPKLKVKFQCLEEGTF-ADPNNCGRYFV 711

  Fly   231 CKDLGNGEFSLEHGVCSDGRFFLATDG--GACVPRSKVKC 268
            |......:|......|:.|..|   |.  |.|||.....|
Mosquito   712 CTLKKLDKFKKSKFKCAAGERF---DPLMGMCVPDLDALC 748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884
ChtBD2 85..130 CDD:214696 13/46 (28%)
CBM_14 146..196 CDD:279884 13/66 (20%)
CBM_14 273..322 CDD:279884
AgaP_AGAP002629XP_563520.4 PTZ00233 <154..>343 CDD:240323
DUF3275 <379..>452 CDD:288521
ChtBD2 525..572 CDD:214696 13/46 (28%)
ChtBD2 584..635 CDD:214696 16/57 (28%)
CBM_14 695..743 CDD:279884 15/51 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.