DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6996 and cht-1

DIOPT Version :9

Sequence 1:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_508588.1 Gene:cht-1 / 180628 WormBaseID:WBGene00000503 Length:617 Species:Caenorhabditis elegans


Alignment Length:194 Identity:44/194 - (22%)
Similarity:64/194 - (32%) Gaps:55/194 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TISGALTFNA--TLICSLVVNGTKMNDPRACNAWIQCIDGSPVSGSCATGLFYDRESQKCLSSSS 78
            |...|.|..|  |.:||...:|...|. ..|..::.|:.....|.||.:||.|....:.|.:|::
 Worm   466 TTRAATTTTASNTNVCSGKSDGFYPNS-NNCGLFVLCLSSKSYSMSCPSGLQYSASLKYCTTSTA 529

  Fly    79 IKCLSSDPCAALPTGFAAD--------PYSCNGYYYC-KDGKGTHGVCNTGMNFNSGTQDCIRDF 134
            ..|..:...|...|..:|.        |.:....:.| |||            |.....||::  
 Worm   530 SGCSVTTTRAPTTTTKSAPTVTTTTRAPTTTTPAFKCTKDG------------FFGVPSDCLK-- 580

  Fly   135 PCSNKMDPDSYCNILPDGVFVKDTDNCNGYQLCWDGQVINGTCPGTFYFKASTAQCDYPQNVEC 198
                               |::          |.:|...|..||....|.|.|..||.|...:|
 Worm   581 -------------------FIR----------CVNGISYNFECPNGLSFHADTMMCDRPDPSKC 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884 12/43 (28%)
ChtBD2 85..130 CDD:214696 9/53 (17%)
CBM_14 146..196 CDD:279884 12/49 (24%)
CBM_14 273..322 CDD:279884
cht-1NP_508588.1 GH18_chitolectin_chitotriosidase 55..423 CDD:119351
Glyco_18 57..399 CDD:214753
CBM_14 481..532 CDD:279884 14/51 (27%)
CBM_14 567..615 CDD:279884 18/90 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.