DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6996 and R02F2.4

DIOPT Version :9

Sequence 1:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_498171.1 Gene:R02F2.4 / 175755 WormBaseID:WBGene00019833 Length:431 Species:Caenorhabditis elegans


Alignment Length:325 Identity:79/325 - (24%)
Similarity:129/325 - (39%) Gaps:52/325 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ICSLVVNGTKMNDPRACNAWIQCIDGSPVSGSCATGLFYDRESQKCLSSSSI-KC--LSSDPCAA 89
            :|..:.:|. .:.....:::|.|..|||...||:|.|.||..::||.....| :|  :|.:.|.:
 Worm   118 VCESLKDGV-YSSGTCSSSYIICNSGSPRFLSCSTPLIYDPTNKKCSWKGMIDECSQVSGEYCES 181

  Fly    90 LPTGFAADPYSCNGYYYCKDGKGTHGVCNTGMNFNSGTQDCIRDFP-----CSNKMDPDSYCNIL 149
              .|..:.....|.::.|.:|......|...:.||.....|  |:|     ||.|.:....|..:
 Worm   182 --DGNISKSECSNVFFSCSEGIAHRRNCPANLVFNPAISSC--DWPKNVMDCSEKSEKPQNCGEV 242

  Fly   150 PDGVFVKDTDNC-NGYQLCWDGQVINGTCPGTFYFKASTAQCDYPQNV-ECDFVPVPDISKKGVC 212
             ||.|  ....| :.:..|.:|..|...||....|......|||..|| |||.            
 Worm   243 -DGYF--SFGRCSSSFSACTNGIPIVMFCPDGLMFSEKNQMCDYEWNVDECDL------------ 292

  Fly   213 PETGGFISDNKTCNGYYYCKDLGNGEFSLEHG----VCSDGR--FF-----LATDGGACV---PR 263
             |:.||:.:.|.......|.::.||.::|:..    .|.:||  .|     |..:..:.:   |.
 Worm   293 -ESSGFMENYKASEALTPCTNMDNGLYALDCTPRVLSCQNGRENIFECPPSLVFNENSLICDYPE 356

  Fly   264 SKVKCGYDRCVGLGNSTIQLANESDDG------C-RGYSICQDGIVIGQGTCPQDEYFDEITQRC 321
            :.:||..:..:.:.:::|...:.|.||      | |.|..|.:|.:|.......:..|.....:|
 Worm   357 TSLKCCMEDALLIRDASIGTYDCSIDGLFSSTLCSRNYHKCSNGQLIPHECADSNAVFSASAAKC 421

  Fly   322  321
             Worm   422  421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884 13/43 (30%)
ChtBD2 85..130 CDD:214696 8/44 (18%)
CBM_14 146..196 CDD:279884 14/50 (28%)
CBM_14 273..322 CDD:279884 12/56 (21%)
R02F2.4NP_498171.1 CBM_14 25..74 CDD:279884
ChtBD2 117..165 CDD:214696 15/47 (32%)
CBM_14 185..229 CDD:279884 9/45 (20%)
ChtBD2 240..283 CDD:214696 11/45 (24%)
CBM_14 310..361 CDD:279884 10/50 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157839
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.