DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6996 and AgaP_AGAP008244

DIOPT Version :9

Sequence 1:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_555219.3 Gene:AgaP_AGAP008244 / 1269088 VectorBaseID:AGAP008244 Length:1199 Species:Anopheles gambiae


Alignment Length:292 Identity:57/292 - (19%)
Similarity:95/292 - (32%) Gaps:65/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PYSCNGYYYCKDGKGTHGVCNTGMNFNSGTQDCIRDFPCS---------NKMDPDSYCNILPDGV 153
            |:|..||..|.........|..|..::...:.|:|.:..|         ..::..:.|..:...|
Mosquito     2 PHSQTGYVTCVGRIKIAAHCPEGSVWSDAVKTCVRQYSSSGVQERTRRDTAIETVTTCATVCPQV 66

  Fly   154 F------VKDTDNCNGYQLCWDGQVINGTCPGTFYFKASTAQCDYPQNVECDFVPVPDISKKGVC 212
            |      :.:..:|..|.||..|.::..:||....|.....:||:.:.|.|:          |..
Mosquito    67 FDPRKLVLVEHRSCTKYNLCVLGLMLTVSCPNDLRFNNERCECDFKEKVHCE----------GED 121

  Fly   213 PETG--GFISDNKTCNGYYYCKDLGNGEFSLEHGVCSDGRFFLATDGGACVPRSKVKCGYDRCVG 275
            |.|.  .:.|.......|         :.:.|.....:....|||........:..:...:..|.
Mosquito   122 PATTTVDYASSTDATTVY---------DSTTEDSTTEESTTELATSESTTEDSTTEESTTEVTVS 177

  Fly   276 LGNSTIQLANESDDGCRGYSICQDGIVIGQGTCPQDEYFDEITQRCTTQVISYTACQISEATT-- 338
            ...:......||..               :||..:....|..|:..||:|.:      ||:||  
Mosquito   178 ESTTEDSTTEESTT---------------EGTVSESTTEDSTTEESTTEVAT------SESTTEE 221

  Fly   339 ------GSQVPSGTTTTTSSTITSTTIAVPVS 364
                  .::|....:||..||...:|..|.||
Mosquito   222 STTEESTTEVTVSESTTEDSTTKESTTEVTVS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884
ChtBD2 85..130 CDD:214696 7/31 (23%)
CBM_14 146..196 CDD:279884 13/55 (24%)
CBM_14 273..322 CDD:279884 7/48 (15%)
AgaP_AGAP008244XP_555219.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.