DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6996 and LOC110437948

DIOPT Version :9

Sequence 1:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_021322240.1 Gene:LOC110437948 / 110437948 -ID:- Length:195 Species:Danio rerio


Alignment Length:237 Identity:55/237 - (23%)
Similarity:73/237 - (30%) Gaps:84/237 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 CNGY---YYCK---------DGKGTHGVCNTGMNFNSGTQDCIRDFPCSNKMDPDSYCNILPDGV 153
            |:.:   :||.         ||...| ||..|.....|   ..|..||.:             |.
Zfish     7 CHNFTQRFYCTEKAESPTPIDGITGH-VCPEGHYCPPG---ATRPVPCHS-------------GT 54

  Fly   154 FV-----KDTDNCNGYQLCWDGQVINGTCPGTFYFKASTAQCDYPQNVECDFVPVPDISKKGVCP 213
            ||     .....|.....|.||..:  .||..||       |  |:....|..|.|    .|...
Zfish    55 FVTVPQASQCWACTAGWYCADGGRL--LCPAGFY-------C--PEGTGYDIRPCP----AGTYS 104

  Fly   214 ETGGFI--SDNKTCNGYYYCKDLGNGEFSLEHGVCSDGRFFLATDGGACVPRSKVKCGYDRCVGL 276
            ...|.|  |:.:.|:|.:|| .|.|.  |...|.||:|.:        |...:.....|.:..|:
Zfish   105 PDSGLISLSECRACDGGHYC-SLQNS--SSVTGQCSEGYY--------CAQGNISPQPYTQNTGV 158

  Fly   277 GNSTIQLANESDDGCRGYSICQDGIVIGQGT-----CPQDEY 313
            |                 .:|..|....|||     ||:..:
Zfish   159 G-----------------GLCPVGHFCPQGTAQPQPCPEGTF 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884
ChtBD2 85..130 CDD:214696 10/40 (25%)
CBM_14 146..196 CDD:279884 13/54 (24%)
CBM_14 273..322 CDD:279884 9/46 (20%)
LOC110437948XP_021322240.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.