DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7290 and CG10725

DIOPT Version :10

Sequence 1:NP_649188.1 Gene:CG7290 / 40211 FlyBaseID:FBgn0036949 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster


Alignment Length:278 Identity:73/278 - (26%)
Similarity:106/278 - (38%) Gaps:31/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KATILAAVALVIACAAPAIADVNVTALCLLVSNGNYVASQSDCSTYYQCQGSSFTAMSCPQGYYF 69
            :.|:||.|||:.:|:| |..||||   |..|.|..:|....:||.|:.|.........||..|||
  Fly     4 RLTLLALVALLGSCSA-ADGDVNV---CSNVVNNLFVPQVGNCSKYFLCMNEIAVPRECPTDYYF 64

  Fly    70 DKNAQQCTGTVPSTCTSNSDPCLGKAVGSFAASSSSCGGYYYCGASGAVRGNCPAGENFNPTTMA 134
            |...|:|...:...|..:   |..:.:.|| ....:|..|..|.....|...|..|..:|..|..
  Fly    65 DARDQECVPLMEVECIGS---CKNRGLSSF-CYDRTCTKYVLCFDGTPVIRQCSDGLQYNALTDR 125

  Fly   135 CVYKNNYPCSESAGDGSTVSVALNLCNLVKNG---FYFGSPSDCSGWNFCQDNVLHSGSCEDGLV 196
            |.|.....|.:            |||:...|.   .:..|.:.|..:..|.|.:....:|..||.
  Fly   126 CDYPQYVDCVD------------NLCSRNNNPDDIVFIPSKARCDKYYICMDGLPQVQNCTSGLQ 178

  Fly   197 FNVQASNCGYKMASSCAQVTNDPSLTGVS------APTTCSSSGATIAATACNQ--YYLCSAGNY 253
            :|....:|.:....:|...:...::...:      |...|.|.||...|....|  ||.|..|..
  Fly   179 YNPSTQSCDFPSKVNCTVESLQRNILPFARAPPRLADIECPSEGAHFIAHQKRQDAYYYCLNGRG 243

  Fly   254 QLMTCPSGYYYDTISKAC 271
            ..:.|..|..:|...:.|
  Fly   244 VTLDCTPGLVFDAKREEC 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7290NP_649188.1 CBM_14 32..77 CDD:426342 15/44 (34%)
CBM_14 91..142 CDD:426342 13/50 (26%)
CBM_14 160..207 CDD:426342 11/49 (22%)
CBM_14 234..277 CDD:426342 12/40 (30%)
ChtBD2 <296..331 CDD:214696
CG10725NP_648647.1 CBM_14 <40..73 CDD:426342 12/32 (38%)
CBM_14 83..134 CDD:426342 13/51 (25%)
CBM_14 150..192 CDD:426342 9/41 (22%)
ChtBD2 216..264 CDD:214696 14/46 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.