DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7290 and obst-B

DIOPT Version :9

Sequence 1:NP_001262093.1 Gene:CG7290 / 40211 FlyBaseID:FBgn0036949 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster


Alignment Length:272 Identity:64/272 - (23%)
Similarity:99/272 - (36%) Gaps:51/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LGKAVGSFAA-SSSSCGGYYYCGASGAVR---GNCPAGENFNPTTMACVYKNNYPCSESAGDGST 152
            |..|||..|. :..|.||:.  |::...|   |:.|:..:..|       :|..|..|::....:
  Fly    16 LALAVGLTATKAQESRGGFR--GSNSQFRVGPGHPPSQRHLPP-------RNRDPVQEASVVPKS 71

  Fly   153 VSVALNL-------CNLVKNGFYFGSPSDCSGWNFCQDNVLHSGSCEDGLVFNVQA---SNCGYK 207
            ...|...       |. ..||||..| ..|..:..|.|.|.....|.||:|||..:   ..|...
  Fly    72 KQTAAEKEYEPTEECP-EPNGFYPDS-KQCDKYYACLDGVPTERLCADGMVFNDYSPIEEKCDLP 134

  Fly   208 MASSCAQ----VTNDPSLTGVSAPTTCSSSGATIA---ATACNQYYLCSAGNYQLMTCPSGYYYD 265
            ....|.:    .|..|||       .|........   ...|:::|.|..|.:.::|||:|..::
  Fly   135 YNIDCMKRSKLQTPQPSL-------HCPRKNGYFGHEKPGICDKFYFCVDGQFNMITCPAGLVFN 192

  Fly   266 TISKAC-------VTRMEARN----DCDRCVGTTATFVNAYSATN-CSDYLYCVNGVQKAVESCP 318
            ..:..|       ||..::.:    :|.:...:.|.....|:..| |..:..||||.......|.
  Fly   193 PKTGICGWPDQVGVTGCKSEDVFDFECPKVNESIAVTHPRYADPNDCQFFYVCVNGDLPRRNGCK 257

  Fly   319 TNYYFNENLGSC 330
            ....|:|...:|
  Fly   258 LGQVFDEEKETC 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7290NP_001262093.1 CBM_14 32..77 CDD:279884
CBM_14 91..142 CDD:279884 14/53 (26%)
CBM_14 160..207 CDD:279884 17/49 (35%)
CBM_14 234..277 CDD:279884 11/52 (21%)
ChtBD2 <296..331 CDD:214696 10/36 (28%)
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 16/50 (32%)
CBM_14 156..204 CDD:279884 9/47 (19%)
CBM_14 233..278 CDD:279884 11/37 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444189
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.