DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7290 and LOC3291167

DIOPT Version :10

Sequence 1:NP_649188.1 Gene:CG7290 / 40211 FlyBaseID:FBgn0036949 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_554263.2 Gene:LOC3291167 / 3291167 VectorBaseID:AGAMI1_011587 Length:132 Species:Anopheles gambiae


Alignment Length:123 Identity:37/123 - (30%)
Similarity:52/123 - (42%) Gaps:12/123 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 GVSAPT---TCSSSGATIAATA--CNQYYLCSAGNYQLMTCPSGYYYDTISKACVTRMEARNDCD 282
            ||||.|   ||..:|..:.|..  |..|:.|..|......|..|:.:|...::|:....|  :|.
Mosquito    17 GVSAITAEPTCRPTGQYLTANPRDCRSYFYCYDGIAYYGVCQQGFRFDESRQSCLPSTVA--ECF 79

  Fly   283 RCVGTTATFVNAYSATNCSDYLYCVNGVQKAVESCPTNYYFNENLGSCVNGLEPKFLC 340
            .|  .|...|:....|:|..::.|..||... .||||...||..:..|  .|..|.:|
Mosquito    80 EC--PTMGMVSLPHPTSCQKFVLCFEGVANE-RSCPTGLLFNRQIHQC--DLSAKVIC 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7290NP_649188.1 CBM_14 32..77 CDD:426342
CBM_14 91..142 CDD:426342
CBM_14 160..207 CDD:426342
CBM_14 234..277 CDD:426342 10/44 (23%)
ChtBD2 <296..331 CDD:214696 11/34 (32%)
LOC3291167XP_554263.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.