DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7298 and CG42397

DIOPT Version :9

Sequence 1:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001163428.1 Gene:CG42397 / 8673976 FlyBaseID:FBgn0259748 Length:178 Species:Drosophila melanogaster


Alignment Length:177 Identity:38/177 - (21%)
Similarity:66/177 - (37%) Gaps:31/177 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 VLQSGKCSANNQTAYNVLANQCTYESASVCSRVTNIPLSDAAVSCSTNGAKSADPKVCGTYYVCT 251
            :|.||..|:...|...:..::.|....:....||.:|   ..|.|:........|. |..||.|.
  Fly    15 LLVSGSTSSGEDTNIKLTTDESTTVEDTTEVLVTTLP---PPVLCADEDLFLPAPD-CREYYQCL 75

  Fly   252 NGKNVATYCPTGDYYDDSLGYCV--SRQVATPVAGCNRCQYATSTFVNAVDS-------NNCSTY 307
            .|:.:...||.|.|:|..|..|.  |:..|.     ::.:..|.:.:|....       .:|:.:
  Fly    76 YGEGILKICPDGLYWDRELNVCAWDSQHCAD-----DKNETTTPSTLNCASGLPFLPYIPDCTKF 135

  Fly   308 YYCNSQGEATLN-----TCPADTFFDESRQGCKSDDDLSTYVPLNGA 349
            ..|      ..|     :||:..::::..|.|  |......:..:||
  Fly   136 IQC------VYNIGFKLSCPSGLYWNQPLQSC--DYTCDNAIEFSGA 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696 12/34 (35%)
ChtBD2 286..334 CDD:214696 8/59 (14%)
CG42397NP_001163428.1 CBM_14 58..102 CDD:279884 13/44 (30%)
ChtBD2 125..163 CDD:214696 7/45 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.