DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7298 and LOC4397840

DIOPT Version :10

Sequence 1:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_061511743.1 Gene:LOC4397840 / 4397840 VectorBaseID:AGAMI1_010727 Length:392 Species:Anopheles gambiae


Alignment Length:38 Identity:11/38 - (28%)
Similarity:18/38 - (47%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 SNNCSTYYYCNSQGEATLNTCPADTFFDESRQGCKSDD 338
            :|:|..|..|....:|.:..||....:|..:|.|:..|
Mosquito   198 ANDCGLYVVCMGNNDAIVQRCPKGLLYDHQQQRCEFAD 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696
ChtBD2 286..334 CDD:214696 9/32 (28%)
LOC4397840XP_061511743.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.