DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7298 and CG13837

DIOPT Version :9

Sequence 1:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster


Alignment Length:201 Identity:44/201 - (21%)
Similarity:70/201 - (34%) Gaps:43/201 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TAVKVGTQLGSIESCQTYYVCQSTGPVQSSCQSGYSYDYKRSSCYPSSEVD-CYWGV----ENPC 94
            :|.::|..:.|..:|..|..|...|..::.|..|:.||.|...|.....|. |...|    ::|.
  Fly    29 SAPQLGVYVASSSNCSKYIYCAGPGSFEAECLDGHYYDEKLERCLDRKLVSRCRDPVGITTKSPS 93

  Fly    95 AGKNNT-----------WVPNTAVCGGWFYCLEGKSAGSGNCPVNQKFDTTTLACVYGTCSNTQG 148
            ..|...           .:||...|..:..|.||........|.:      .::|      |...
  Fly    94 MVKKPAQKAEPLAITLRLLPNAGPCYPYMVCYEGAGLAKACTPAH------LVSC------NRMQ 146

  Fly   149 TNETVL---ESLCDVVPPGQYFGDTESCSTWHYCESTSTGLVLQSGKCSANNQTAYNVLANQCTY 210
            |.|.::   |.:...:|      ...:|:.::||.|.|. ||   .:|..|....|.  ...|..
  Fly   147 TRENIINCQEGVYGFMP------HPRNCAYFYYCSSGSK-LV---HRCHLNYTWHYE--RRSCVQ 199

  Fly   211 ESASVC 216
            :|..:|
  Fly   200 QSERMC 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696
ChtBD2 286..334 CDD:214696
CG13837NP_651113.1 CBM_14 36..81 CDD:279884 12/44 (27%)
CBM_14 154..203 CDD:279884 14/60 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.