DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7298 and CG10725

DIOPT Version :9

Sequence 1:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster


Alignment Length:295 Identity:70/295 - (23%)
Similarity:106/295 - (35%) Gaps:56/295 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGKLLLATILCLMGGQALGDAILEGNYNVTAVCTAVKVGTQLGSIESCQTYYVCQSTGPVQSSC 65
            |..:|.|..::.|:|..:..|    |:.|   ||:.|.....:..:.:|..|::|.:...|...|
  Fly     1 MISRLTLLALVALLGSCSAAD----GDVN---VCSNVVNNLFVPQVGNCSKYFLCMNEIAVPREC 58

  Fly    66 QSGYSYDYKRSSCYPSSEVDCYWGVENPCAGKNNTWVPNTAVCGGWFYCLEGK------------ 118
            .:.|.:|.:...|.|..||:|....:|  .|.::.....|  |..:..|.:|.            
  Fly    59 PTDYYFDARDQECVPLMEVECIGSCKN--RGLSSFCYDRT--CTKYVLCFDGTPVIRQCSDGLQY 119

  Fly   119 SAGSGNCPVNQKFDTTTLACVYGTCSNTQGTNETVLESLCDVVPPGQYFGDTESCSTWHYCESTS 183
            :|.:..|...|..|     ||...||.....::.|            :......|..::.|   .
  Fly   120 NALTDRCDYPQYVD-----CVDNLCSRNNNPDDIV------------FIPSKARCDKYYIC---M 164

  Fly   184 TGLVLQSGKCSANNQTAYNVLANQCTYESASVC---SRVTNI------PLSDAAVSCSTNGAK-S 238
            .||. |...|::..|  ||.....|.:.|...|   |...||      |...|.:.|.:.||. .
  Fly   165 DGLP-QVQNCTSGLQ--YNPSTQSCDFPSKVNCTVESLQRNILPFARAPPRLADIECPSEGAHFI 226

  Fly   239 ADPKVCGTYYVCTNGKNVATYCPTGDYYDDSLGYC 273
            |..|....||.|.||:.|...|..|..:|.....|
  Fly   227 AHQKRQDAYYYCLNGRGVTLDCTPGLVFDAKREEC 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696 12/35 (34%)
ChtBD2 286..334 CDD:214696
CG10725NP_648647.1 CBM_14 35..73 CDD:279884 8/37 (22%)
CBM_14 83..134 CDD:279884 10/59 (17%)
CBM_14 150..192 CDD:279884 11/47 (23%)
ChtBD2 216..264 CDD:214696 15/46 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444210
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.