DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7298 and CG11570

DIOPT Version :9

Sequence 1:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001356902.1 Gene:CG11570 / 39357 FlyBaseID:FBgn0036230 Length:262 Species:Drosophila melanogaster


Alignment Length:226 Identity:47/226 - (20%)
Similarity:68/226 - (30%) Gaps:95/226 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 CQTYYVCQSTGPVQSSC-------QSGYSYDYKR-SSCYPSSEVDCYWGVENPCAGKNNTWVPN- 104
            |..|||||.....:..|       |..|..|||. |:|                    ||::|: 
  Fly    56 CSKYYVCQKGRAYEQQCPLNLFWSQMTYRCDYKEYSNC--------------------NTYIPSP 100

  Fly   105 --------TAVCGGWFYCLEGKSAGSGNCPVNQKFDTTTLACV---YGTCSN------------- 145
                    :|..|.   |..........|..|.::.:....||   ||.|.|             
  Fly   101 NHDVEVIFSAYPGD---CRRFYETRILRCEQNLQWSSVYQRCVVPQYGDCQNSPVTVPPVVPFTP 162

  Fly   146 ---------------------TQGTNETV-----------LESLCDVVPPGQYFGDTESCSTWHY 178
                                 |.||...:           ::|||:..||..|.....||..:.:
  Fly   163 LPTYPPVPTVPATVIPYDPMPTAGTPPPITPMESLPLPIDVQSLCNNSPPNAYIPYPGSCKKFIH 227

  Fly   179 CESTSTGLVLQSGKCSANNQTAYNVLANQCT 209
            |..|:|.|     .|:.::.  :|...:.||
  Fly   228 CGPTATIL-----SCAGSSN--WNPAQHACT 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696
ChtBD2 286..334 CDD:214696
CG11570NP_001356902.1 CBM_14 51..93 CDD:307643 13/36 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.