DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7298 and CG5897

DIOPT Version :9

Sequence 1:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001356901.1 Gene:CG5897 / 39346 FlyBaseID:FBgn0036220 Length:343 Species:Drosophila melanogaster


Alignment Length:325 Identity:73/325 - (22%)
Similarity:121/325 - (37%) Gaps:60/325 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LGSIESCQTYYVCQSTGPV-QSSCQSGYSYDYKRSSCYPSSEVDCYWGVENPCAGKNN-TWVPNT 105
            :|....||.:..||....: :.||..|..|.::..:|..:|:..|:..:...||.... .:|.|.
  Fly    38 IGDPSDCQAWGYCQDNKLIDRRSCTEGLLYSFRDGTCKRASDTICHSQLSEICASLEPWNYVANP 102

  Fly   106 AVCGGWFYCLEGKSAGSGNCPVNQKFDTTTLACVYGTCSNTQGTNETVLESLCDVVPPGQYFGDT 170
            |.|..:..|.:......|:|.|.|.|......|:.......|       :::|..:..|.:.||.
  Fly   103 ADCRRFVKCADLDDPTWGDCGVGQVFSNKKQTCLEEVAGCPQ-------DNICSHMKDGSFVGDP 160

  Fly   171 ESCSTWHYCESTSTGLVLQSGKCSANNQTAYNVLANQCTYESASVCSR-----VTNIPLSDAAVS 230
            :||..::.|.: ..|.:|   .||....  :|.....|.......||:     :...|.:|..: 
  Fly   161 KSCQIYYKCHN-GFGTML---NCSVGRY--FNRKTGNCQSWMPHYCSKDDEDNILTPPSTDHNI- 218

  Fly   231 CSTNGAKSAD-----PKV--CGTYYVCTNGKNVATY--CPTGDYY-----------DDSLGY--C 273
            ||....:..|     |.:  |..||.||:..:|..:  ||.|.::           |:|..|  |
  Fly   219 CSKYYQRDRDGVQLLPDLMTCYGYYSCTSQFDVGKWSSCPWGLHFEWWSQRCGSPKDNSCSYDRC 283

  Fly   274 VSRQVATPVAGCNRCQYATSTFVNAVDSNNCSTYYYCNSQGEATLNTCPAD-TFFDESRQGCKSD 337
            .:|         |:...||   :|    ..|..:..|......:...||.| .:|:|..:.|..:
  Fly   284 ANR---------NQLMVAT---IN----TGCREFTICQDNRSKSSQKCPEDYPYFNELLRQCTDE 332

  Fly   338  337
              Fly   333  332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696 14/56 (25%)
ChtBD2 286..334 CDD:214696 11/48 (23%)
CG5897NP_001356901.1 ChtBD2 146..192 CDD:214696 12/51 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464282
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 1 1.000 - - FOG0005299
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.