DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7298 and Muc68D

DIOPT Version :9

Sequence 1:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster


Alignment Length:323 Identity:76/323 - (23%)
Similarity:121/323 - (37%) Gaps:78/323 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 STGPVQSSCQSGYSYDYKRSSCYPSSEVDCYWGVENP-CAGKNNTWVPNTAVCGGWFYCLEGKSA 120
            |...:.|:..:.|:.|      .|:|:.......||| .:|.:::..|.           ||.:.
  Fly  1216 SESGITSTTGAPYTTD------NPASQEPSPSAPENPGDSGNSSSESPP-----------EGATP 1263

  Fly   121 GSGNCP------------------VNQKFDTTTLACVYGTCSNTQGTNETVLESLCDVVPPGQYF 167
            .:.|.|                  ...|.:|:||....||   |.|..|...:  |..:|.|.:.
  Fly  1264 CTPNAPKKSTTSSYTAHPTPKYTTEGNKAETSTLKSPTGT---TPGHQEDRTD--CSNMPNGIFL 1323

  Fly   168 GDTESCSTWHYCESTSTGLVLQSGKCSANNQTAYNVLANQCTYESASVC------SRVTNIPL-S 225
            .|.:||:.::.|   ..|..: :|.|..|  ..:::....|.:.|...|      ..||..|. :
  Fly  1324 RDFQSCNKYYVC---LNGKAI-AGHCPRN--LHFDIKRKVCNFPSLVDCPLDEAPENVTKKPSDT 1382

  Fly   226 DAAVSCST--NGAKSADPKVCGTYYVCTNGKNVATYCPTGDYYDDSLGYC--------------- 273
            ::...|.:  |||...|||.|..:|||.||:.:...||.|.::|....:|               
  Fly  1383 ESTPDCKSLRNGAYVRDPKSCSRFYVCANGRAIPRQCPQGLHFDIKSNFCNYPILVQCSLEESQA 1447

  Fly   274 --VSRQVATPVAGCNRCQYATSTFVNAVDSNNCSTYYYCNSQGEATLNTCPADTFFDESRQGC 334
              ....:|..|..|.:.:  ..|....|..:|  .||.| .:|:|.|:.|....:||...|.|
  Fly  1448 DAHGALLAEGVPDCTKVK--EDTRFGDVKQHN--KYYVC-LKGKAVLHYCSPGNWFDLRSQKC 1505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696 14/51 (27%)
ChtBD2 286..334 CDD:214696 13/47 (28%)
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 13/57 (23%)
CBM_14 1388..1440 CDD:279884 18/51 (35%)
ChtBD2 1459..1505 CDD:214696 14/50 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.