DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7298 and CG33985

DIOPT Version :9

Sequence 1:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster


Alignment Length:344 Identity:65/344 - (18%)
Similarity:110/344 - (31%) Gaps:105/344 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GKLLLATILCLMGGQALGDAILEGNYNVTAVCTAVKVGTQLGSIESCQTYYVCQSTGPVQSSCQS 67
            |.:|::.:........:.|...:|| |::.|.          |.:||..|..|.........|:.
  Fly     8 GSILVSLLFLATSHADVFDECNDGN-NLSFVT----------SPKSCAHYIFCNGDESYDGECED 61

  Fly    68 GYSYDYKRSSCYPSSEVDCYWGVENPCAGKNNTWVPNTAVCGGWFYCLEGKSAGSGNCPVNQKFD 132
            |..:......|.|..::||..|.|  ...:|.|...:|.:..                      :
  Fly    62 GEYFSQDMEMCEPMGDIDCRTGSE--VQRENTTDSSSTEITS----------------------E 102

  Fly   133 TTTLACVYGTCSNTQGTNETVLESLCDVVPPGQYFGDTESCSTWHYCESTSTGLVLQSGKCSANN 197
            ::|::.|..|         |:..|....:.|.                      |.|||..|..:
  Fly   103 SSTISTVVIT---------TLAPSAVVTLRPS----------------------VNQSGASSTTS 136

  Fly   198 -QTAYNVLANQCTYESASVCSRVTNIPLSDAAVSCSTNGAKSADPKVCGTYYVCTNGKNVATYCP 261
             ..|..::.       .:||.::.|  .|..|:..:.|.        |..||:|..|..:...|.
  Fly   137 VSPAIEIIV-------TNVCPQLDN--QSRIALLPNQNS--------CSDYYICYRGVALPMSCA 184

  Fly   262 TGDYYDDSLGYC-------VSRQVATPVAGCNRCQYATSTFVNAVD----SNNCSTYYYCNSQGE 315
            |..:::...|.|       .......|...|.|         :.:|    |:||:.:|.|.| |.
  Fly   185 TSLHFNSLTGKCDHPENVRCLAMTYNPREQCKR---------HVIDVYPHSDNCNYFYQCRS-GY 239

  Fly   316 ATLNTCPADTFFDESRQGC 334
            ..:..||....:|..::.|
  Fly   240 LMVQQCPFFYGWDYEKRSC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696 9/41 (22%)
ChtBD2 286..334 CDD:214696 12/51 (24%)
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 12/56 (21%)
CBM_14 160..202 CDD:279884 10/49 (20%)
ChtBD2 215..259 CDD:214696 14/54 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.