DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7298 and obst-E

DIOPT Version :9

Sequence 1:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster


Alignment Length:263 Identity:58/263 - (22%)
Similarity:87/263 - (33%) Gaps:82/263 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLLLATILC--LMGGQALGDAILEGNYNVTAVCTAVKVGTQLGSIESCQTYYVCQSTGPVQSSCQ 66
            |:|::.:||  :.|..|||          :..|..  ...:..|.:.|.:|..||...||:..|.
  Fly     3 KILISALLCVAMFGSMALG----------SPECPT--PNGRFASGDQCDSYTECQDGTPVEKLCP 55

  Fly    67 SGYSYDYKRSSCYPSSEVDCYWGVENPCAGKNNTWVPNTAVCGGWFYCLEGKSAGSGNCPVNQKF 131
            .|..: ::|:    .:..:|.:...:.|..:......|                |:..||....|
  Fly    56 DGLLF-HQRT----KATGECTYAPYSTCKERARLQPAN----------------GTEECPRQFGF 99

  Fly   132 ----DTTTLA----CVYGTCSNTQGTNETVLESLCDVVPPGQYFG-DTESCSTWHYCESTSTGLV 187
                |.|...    |.:|..|.|:          |   |.|..|. :|..|......||      
  Fly   100 YPNGDATKCGVYRNCAHGVASLTK----------C---PEGLAFNEETYQCDWPDLVES------ 145

  Fly   188 LQSGKCSANNQTAYNVLANQCTYESASVCSRVTNIPLSDAAVSCSTNGAKS--ADPKVCGTYYVC 250
                 |:|.....:|..|.....:||:            |||..|..|...  ..|:.|..|:||
  Fly   146 -----CNAEAYLGFNCPAADSADDSAA------------AAVDVSPEGELRYYRHPQTCKKYFVC 193

  Fly   251 TNG 253
            .||
  Fly   194 VNG 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696 7/15 (47%)
ChtBD2 286..334 CDD:214696
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 11/48 (23%)
CBM_14 95..146 CDD:307643 15/74 (20%)
CBM_14 180..225 CDD:307643 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.