DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7298 and Muc68E

DIOPT Version :9

Sequence 1:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster


Alignment Length:279 Identity:63/279 - (22%)
Similarity:101/279 - (36%) Gaps:62/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LGDAILEGNYNVTAVCTAVKVGTQLGSIESCQTYYVCQSTGPVQSSCQSGYSYDYKRSSCYPSSE 83
            |||:.|....|.||           |.:.:..|.....::.|:.||.:|        ::..|||.
  Fly  1566 LGDSTLSPGENSTA-----------GQVSTSTTLVYDTTSSPIPSSSRS--------TTLEPSSS 1611

  Fly    84 ------------VDCYWGVENPCAGKNNTWVPNTAVCGGWFYCLEGKSAGSGNCPVNQKFDTTTL 136
                        :.|..|.:         ::|:...|..:.:|..|... ...||.|..:|....
  Fly  1612 SSPETTTSSLPPLSCSTGYQ---------YLPHPTNCHKYIHCSNGHEL-IMECPANLYWDYHKF 1666

  Fly   137 ACV--YGTCSN-TQGTNETVLESLCDVVPPG-QYFGDTESCSTWHYCESTSTGLVLQSGKCSANN 197
            .|.  .|.|.| |:.:|..  |.:|.   || .:......|:.:..|   |.|:.|:. ||.  :
  Fly  1667 VCSGDSGVCYNDTENSNPE--EKVCG---PGVDFLAHPTDCTMYLQC---SNGVALER-KCP--D 1720

  Fly   198 QTAYNVLANQCTYESASVCSRVTNIPLSDAAVSCSTNGAKSADPKVCGTYYVCTNGKNVATYCPT 262
            ...:|.....|.: |...|   ||:..|. ::||:.....:.....|..|..|...:.|...|.:
  Fly  1721 PLYWNPEIKSCDW-SNKYC---TNLRASQ-SISCAAGMNFNVFQSDCSKYVKCFGLRGVVMSCNS 1780

  Fly   263 GDYYDDSLGYC-VSRQVAT 280
            |.|::.....| .||:..|
  Fly  1781 GLYWNPVSQVCEKSRRFCT 1799

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696 8/35 (23%)
ChtBD2 286..334 CDD:214696
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696 7/29 (24%)
ChtBD2 1626..1668 CDD:214696 10/51 (20%)
ChtBD2 1688..1734 CDD:214696 12/55 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.