DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7298 and cpg-1

DIOPT Version :9

Sequence 1:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001021159.1 Gene:cpg-1 / 175586 WormBaseID:WBGene00000465 Length:584 Species:Caenorhabditis elegans


Alignment Length:270 Identity:58/270 - (21%)
Similarity:82/270 - (30%) Gaps:68/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 CGGWFYCLEGKSAGSGNCPVNQKFDTTTLACVY--------GTCSNTQGTNETVLESLCDVVPPG 164
            |...|....|..:...:||.:..:|...:||.|        |...:...|.|........|.|  
 Worm    74 CSPQFLTCSGGISRIMDCPADLIYDPRIVACEYSYNVPQCGGVPQDVTSTQEAYPSEETTVNP-- 136

  Fly   165 QYFGDTESCSTWHYCESTSTGLVLQSGKCSANNQTAYNVLANQCTYES-ASVCSRVTNIPLSDAA 228
              :...|        |:|:|         .|.:.|    :..:.|.|: |.|....|..|..|..
 Worm   137 --YAPVE--------EATTT---------PAEDVT----VPEETTTEAYAPVDDYSTTTPAEDVP 178

  Fly   229 VSCSTNGAKSADPKVCGTYYVCTNGKNVATYCPTGDYYDDSLGYCVSRQVATPVAGCNRCQYATS 293
            |...|    :|.|                 |.|...|   :.|...:.:..|..|....|.....
 Worm   179 VPVET----TASP-----------------YAPIVPY---TTGAPAADEPVTRSAVTKSCVGKAD 219

  Fly   294 TFVNAVDSNNCSTYYYCNSQGEATLNTCPADTFFDESRQGCKSDDDLSTYVPLNGACKGATAEGS 358
            .|.:   ...||.:|...|.|......|||...|||:|..|    |....||   .|...:....
 Worm   220 GFYS---FGECSDHYTACSNGYLIPMQCPARLAFDEARVIC----DYVMNVP---ECTNGSGNDE 274

  Fly   359 EETDNSTTDA 368
            ...|.:|.::
 Worm   275 GSADETTPES 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696 6/34 (18%)
ChtBD2 286..334 CDD:214696 14/47 (30%)
cpg-1NP_001021159.1 CBM_14 61..113 CDD:279884 9/38 (24%)
CBM_14 214..266 CDD:279884 18/61 (30%)
CBM_14 <537..576 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157864
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.