DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7298 and LOC110437948

DIOPT Version :9

Sequence 1:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_021322240.1 Gene:LOC110437948 / 110437948 -ID:- Length:195 Species:Danio rerio


Alignment Length:181 Identity:40/181 - (22%)
Similarity:56/181 - (30%) Gaps:54/181 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PCAGKNNTWVPNTAVC----GGWFYCLEGK----SAGSGNCPVNQKFDTTTLACVYGTCSNTQGT 149
            ||.......||..:.|    .|| ||.:|.    .||. .||....:|..  .|..||.|...| 
Zfish    49 PCHSGTFVTVPQASQCWACTAGW-YCADGGRLLCPAGF-YCPEGTGYDIR--PCPAGTYSPDSG- 108

  Fly   150 NETVLESLCDVVPPGQYFGDTESCSTWHYCESTSTGLVLQSGKCSANNQTAYNVLANQCTYESAS 214
                |.||          .:..:|...|||...::..|  :|:||.....|...::.|...::..
Zfish   109 ----LISL----------SECRACDGGHYCSLQNSSSV--TGQCSEGYYCAQGNISPQPYTQNTG 157

  Fly   215 VCSRVTNIPLSDAAVSCSTNGAKSADPKVCGTYYVCTNGKNVATYCPTGDY 265
            |..                         :|...:.|..|......||.|.:
Zfish   158 VGG-------------------------LCPVGHFCPQGTAQPQPCPEGTF 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696 6/27 (22%)
ChtBD2 286..334 CDD:214696
LOC110437948XP_021322240.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.