DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7298 and LOC105375809

DIOPT Version :9

Sequence 1:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_016860927.1 Gene:LOC105375809 / 105375809 -ID:- Length:187 Species:Homo sapiens


Alignment Length:172 Identity:42/172 - (24%)
Similarity:56/172 - (32%) Gaps:47/172 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 PPGQYFGD-----TESCSTWHYCESTSTGLVLQSGKCSANNQTAYNVLANQCTYESASVCSRVTN 221
            |||.:.|.     |::|.:.|||..   |....||...|..:..|  ||....:..|. |     
Human     4 PPGSFCGTSGTPATQACPSGHYCPG---GSETHSGAPQACPEHTY--LATDGGHSQAE-C----- 57

  Fly   222 IPLSDAAVSCSTNGAKSADPKVCGTYYVCTNGKNVATYCPTGDYYDDSLGYCVSRQVATPVAGCN 286
            :| ..|...|...|..|.:...|...:.|. |...|.:||.|.:..:            |.|...
Human    58 LP-CPAGYHCPWPGLSSFEDHPCPPGHWCL-GDQGAFFCPPGTFRSE------------PGASAQ 108

  Fly   287 RCQYATSTFVNAVDSNNCSTYYYC---NSQGEATLNT--CPA 323
            .            |...|...|:|   ..||.|.:..  |||
Human   109 E------------DCELCPPGYHCPDPELQGHANVFAIPCPA 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696 7/34 (21%)
ChtBD2 286..334 CDD:214696 10/43 (23%)
LOC105375809XP_016860927.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.