DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and CG17145

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001262098.1 Gene:CG17145 / 40215 FlyBaseID:FBgn0036953 Length:334 Species:Drosophila melanogaster


Alignment Length:302 Identity:60/302 - (19%)
Similarity:84/302 - (27%) Gaps:98/302 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CLGRQEGDLVPHPLDCNGYFSCSRVPTLLY--CDQGLQFDENRAICDLPENTNCRPVATGTVESA 105
            |..|.: ..|..|..|.||:.|:...|.||  |.|...|:....:|.....::|   .|.|.|..
  Fly    90 CADRAK-QFVADPKSCYGYYYCADEETALYGTCPQETHFNATTQMCSRQHESDC---TTSTFEYC 150

  Fly   106 ----NGL-ADNSELNWWPHKPKPVFVAVDVTSGQPVNPMEKYDPEHIECRHYGAYFLPHPRNCGL 165
                ||: .||.:                                                .|.:
  Fly   151 SIVKNGVNFDNLQ------------------------------------------------GCNM 167

  Fly   166 YFICAYGHLHRHQCGRGTAWNFEKSECQLSDQAICYGESQISEPH---TDVETTMKVPTANSEGA 227
            |.:|..|.|....|.: |.:.....||.......|       :.|   |||......|..|...|
  Fly   168 YHVCEKGVLKDKTCSK-TYYQASTGECVSKALVDC-------DAHPLPTDVCGKASKPYENKFVA 224

  Fly   228 VTVCYIVGSSEYTTLQQFLTSPEITELPPVTP-----PSPPRAEANALTCPSTKQSYMSH----- 282
                     .|.|....|..:.:....|...|     |.....:|::..|.:....|.||     
  Fly   225 ---------DEATCRGYFYCAKQKDGTPDPNPVWNQCPQDRFFDASSQMCITPSSVYCSHDRCDG 280

  Fly   283 ---------PEDCSKYYICIGGMPVLTSCPKGLFWDQKSGFC 315
                     .:.|..|..|..|:.|........|:|.:.|.|
  Fly   281 RTASFVVSATKGCRNYLSCSDGVTVSERSCGNYFFDDQQGAC 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 15/52 (29%)
CBM_14 156..198 CDD:279884 9/41 (22%)
CBM_14 272..321 CDD:279884 13/58 (22%)
CG17145NP_001262098.1 CBM_14 91..142 CDD:279884 14/51 (27%)
CBM_14 278..327 CDD:279884 9/45 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444032
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.