DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and CG7298

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster


Alignment Length:298 Identity:69/298 - (23%)
Similarity:107/298 - (35%) Gaps:73/298 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 HLSHIC----LGRQEGDLVPHPLDCNGYFSC-SRVPTLLYCDQGLQFDENRAICDLPENTNCRPV 97
            :::.:|    :|.|.|.:.    .|..|:.| |..|....|..|..:|..|:.|......:|   
  Fly    29 NVTAVCTAVKVGTQLGSIE----SCQTYYVCQSTGPVQSSCQSGYSYDYKRSSCYPSSEVDC--- 86

  Fly    98 ATGTVESANGLADNSELNWWPHKPKPVFVAV-----------DVTSGQ-PVNPMEKYDPEHIECR 150
             ...||:.....:|:   |.|:      .||           ...||. |||  :|:|...:   
  Fly    87 -YWGVENPCAGKNNT---WVPN------TAVCGGWFYCLEGKSAGSGNCPVN--QKFDTTTL--- 136

  Fly   151 HYGAYFLPHPRNCGLYFICAYGHLHRHQCGRGTAWNFEKSECQLSDQAICYGESQISEPHTDVET 215
                             .|.||.....|   ||.....:|.|.:......:|:::........|:
  Fly   137 -----------------ACVYGTCSNTQ---GTNETVLESLCDVVPPGQYFGDTESCSTWHYCES 181

  Fly   216 TMKVPTANSEGAVT---VCYIVGSSEYTTLQQFLTSPEITELPPVTPPSPPRAEANALTCPSTKQ 277
            |       |.|.|.   .|.....:.|..|....|....:....||  :.|.::| |::| ||..
  Fly   182 T-------STGLVLQSGKCSANNQTAYNVLANQCTYESASVCSRVT--NIPLSDA-AVSC-STNG 235

  Fly   278 SYMSHPEDCSKYYICIGGMPVLTSCPKGLFWDQKSGFC 315
            :..:.|:.|..||:|..|..|.|.||.|.::|...|:|
  Fly   236 AKSADPKVCGTYYVCTNGKNVATYCPTGDYYDDSLGYC 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 14/55 (25%)
CBM_14 156..198 CDD:279884 8/41 (20%)
CBM_14 272..321 CDD:279884 17/44 (39%)
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696 14/35 (40%)
ChtBD2 286..334 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444086
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.