DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and CG10140

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster


Alignment Length:336 Identity:63/336 - (18%)
Similarity:99/336 - (29%) Gaps:139/336 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQCSWAYVLALSICFQLGAGHAVDQSWELPKVRHTVGHLSHICLGRQEGDLVPHPLDCNGY---- 61
            :||.|.|..           :|..||                |:...:.|.:|   .|..:    
  Fly    84 LQCEWPYEF-----------NANTQS----------------CVHPGDADCLP---TCEAFNFST 118

  Fly    62 FS----CSRV-------PTLLYCDQGLQFDENRAICDLPENTNCRPVATGTVESANGLADNSELN 115
            ||    |:|.       |.|..|..|||::.....||.|:|.:|       |||...:..|:   
  Fly   119 FSYQRTCTRYVLCYYGKPVLRQCQDGLQYNSATDRCDFPQNVDC-------VESECSIYSNA--- 173

  Fly   116 WWPHKPKPVFVAVDVTSGQPVNPMEKYDPEHIECRHYGAYFLPHPRNCGLYFICAYGHLHRHQCG 180
                                                |...::|...:|..||||..|......|.
  Fly   174 ------------------------------------YHLRYVPSKVSCQKYFICGNGIPREQTCT 202

  Fly   181 RGTAWNFEKSECQLSDQAICYGESQISEPHTDVETTMKVPTANSEGAVTVCYIVGSSEYTTLQQF 245
            .|..::.:...|.:..::.|                 ::|....:                :|| 
  Fly   203 AGLHFSTKCDCCDIPSKSDC-----------------QIPAVERK----------------VQQ- 233

  Fly   246 LTSPEITELPPVTPPSPPRAEANALTCPSTKQSYMSHPEDCSKYYICIGGMPVLTSCPKGLFWDQ 310
                 ::.|.|||...         .||.:...:..|......||.|:.|..::..|..||::|.
  Fly   234 -----LSRLSPVTTVG---------ICPPSGVHFYVHESRRDAYYYCVDGHGLVLDCSAGLWYDP 284

  Fly   311 KSGFCEMEKNV 321
            ....|...:||
  Fly   285 TVQECREPQNV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 18/65 (28%)
CBM_14 156..198 CDD:279884 10/41 (24%)
CBM_14 272..321 CDD:279884 12/48 (25%)
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 8/48 (17%)
CBM_14 111..161 CDD:279884 15/49 (31%)
CBM_14 178..222 CDD:279884 10/43 (23%)
CBM_14 246..295 CDD:279884 12/48 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444037
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27026
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.