DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and CG11570

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001356902.1 Gene:CG11570 / 39357 FlyBaseID:FBgn0036230 Length:262 Species:Drosophila melanogaster


Alignment Length:228 Identity:48/228 - (21%)
Similarity:71/228 - (31%) Gaps:65/228 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 DPEHIECRHYGAYFLPHPRNCGLYFICAYGHLHRHQCGRGTAWNFEKSECQLSDQAICYGESQIS 207
            ||.|       ...||:|.:|..|::|..|..:..||.....|:.....|...:.:.|  .:.|.
  Fly    43 DPNH-------NVMLPYPNDCSKYYVCQKGRAYEQQCPLNLFWSQMTYRCDYKEYSNC--NTYIP 98

  Fly   208 EPHTDVETTMK-------------------------------VPTAN--SEGAVTVCYIVGSSEY 239
            .|:.|||....                               ||...  ....|||..:|   .:
  Fly    99 SPNHDVEVIFSAYPGDCRRFYETRILRCEQNLQWSSVYQRCVVPQYGDCQNSPVTVPPVV---PF 160

  Fly   240 TTLQQFLTSPEITEL-------------PPVTP----PSPPRAEANALTCPSTKQSYMSHPEDCS 287
            |.|..:...|.:...             ||:||    |.|  .:..:|...|...:|:.:|..|.
  Fly   161 TPLPTYPPVPTVPATVIPYDPMPTAGTPPPITPMESLPLP--IDVQSLCNNSPPNAYIPYPGSCK 223

  Fly   288 KYYICIGGMPVLTSCPKGLFWDQKSGFCEMEKN 320
            |:..| |....:.||.....|:.....|....|
  Fly   224 KFIHC-GPTATILSCAGSSNWNPAQHACTTYSN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884
CBM_14 156..198 CDD:279884 11/41 (27%)
CBM_14 272..321 CDD:279884 12/49 (24%)
CG11570NP_001356902.1 CBM_14 51..93 CDD:307643 10/41 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.