DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and CG7248

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster


Alignment Length:314 Identity:66/314 - (21%)
Similarity:104/314 - (33%) Gaps:99/314 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 HPLDCNGYFSC-SRVPTLLYCDQGLQFDENRAICDLPENTNCRPVATGTVESANGLADNSELNWW 117
            :|.:|:.|.:| .....|.||..|..|:....|||.|...:|.|:...|                
  Fly    72 YPYNCSAYITCYDSCADLEYCPDGKLFNSPLQICDTPGAVDCEPLPYPT---------------- 120

  Fly   118 PHKPKPVFVAVDVTSGQPVNPMEKYDPEHIECRHYGAYFLPHPRNCGLYFICAYGHLHRHQCGRG 182
               |.|       |...|.||.       :..|:  ...||...||..:::|.......::|...
  Fly   121 ---PSP-------TESPPENPC-------LGTRN--NTLLPSAENCNEFYLCVNDQSKVYRCPGE 166

  Fly   183 TAWNFEKSECQLSDQAICYGESQISEPHTDVETTMKVPTANSEGAVTVC---------------- 231
            ..:|.:.:.|...|...|||:....:|   ::|     |..:|.:.|.|                
  Fly   167 MLFNPDLNICDDKDNVWCYGDRTTPDP---LDT-----TTPAEESFTKCEDQEKGTFFPDPENCQ 223

  Fly   232 ---YIVGSSEYTTLQQFLTSPEITELPPV----------------TPPSPPRAEANALT--CPST 275
               |..|:..||    .|..|......|:                ||.|.|..:.::.|  .|::
  Fly   224 QYYYCWGNKSYT----ILPCPVDNWFNPISGNCGPDIAPDACRETTPTSTPTIDTSSSTTVAPTS 284

  Fly   276 KQSYMSHP-------------EDCSKYYICI-GGMPVLTSCPKGLFWDQKSGFC 315
            .:..:.:|             .||..|.:|: .|......||...::|.|:|.|
  Fly   285 TEDSVGNPCADQELGASFPIKSDCQSYLLCLNNGESTTAKCPSNAWFDPKTGDC 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 13/40 (33%)
CBM_14 156..198 CDD:279884 9/41 (22%)
CBM_14 272..321 CDD:279884 13/58 (22%)
CG7248NP_648530.1 CBM_14 62..113 CDD:279884 13/40 (33%)
CBM_14 136..182 CDD:279884 10/47 (21%)
CBM_14 207..261 CDD:279884 8/57 (14%)
CBM_14 293..347 CDD:279884 11/46 (24%)
CBM_14 367..421 CDD:279884
CBM_14 470..522 CDD:279884
CBM_14 544..597 CDD:279884
CBM_14 630..678 CDD:279884
CBM_14 710..758 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.