DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and CG17826

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster


Alignment Length:314 Identity:74/314 - (23%)
Similarity:109/314 - (34%) Gaps:92/314 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 EGDLVPHPLDCNGYFSC-SRVPTLLYCDQGLQFDE--NRAICDL-----------------PENT 92
            :|::.|:|.||.||..| ..:..:|.|..|..|:.  ||.:.|.                 .:.|
  Fly    84 DGEITPNPDDCAGYLECVDGIIVILTCPDGDYFNSTLNRCVEDTCGVCNGNGTTCTDGELKVDPT 148

  Fly    93 NCRPVATGTVESANGLADNSELNWWPHKPKPVFVAVDVTSGQPVNPMEK---YDPEHI--ECRHY 152
            ||    .|.:..:||       ||         |:.....|...|.:.:   .|.|.|  .|:..
  Fly   149 NC----AGYLACSNG-------NW---------VSKQCADGAYFNAILETCVQDDEGICVNCKEG 193

  Fly   153 GAYFLPHPRNCGLYFICAYGHLHRHQCGRGTAWNFEKSECQLSDQAICYGESQISEPHTDVETTM 217
            ....|   .:|.:|.||:.|......|..|..||.:...|.: |...|.|.....   ||.|  :
  Fly   194 STKPL---ADCTMYEICSGGKYVTKSCDSGYYWNSQSEVCDV-DNGQCNGNGTTC---TDGE--L 249

  Fly   218 KVPTANSEGAVTVCYIV-------------GSSEYTTLQQFLTSPEITELPPVTPPSPPRAEANA 269
            ||...|..|     |:.             |:....||:..:...|                   
  Fly   250 KVDPTNCAG-----YLACSNGNWVSKQCADGAYFNVTLETCVQDDE------------------- 290

  Fly   270 LTCPSTKQSYMSHPEDCSKYYICIGGMPVLTSCPKGLFWDQKSGFCEMEKNVKC 323
            ..|.:.|:.......||:.|.||.||..|..||..|.:|:.:|..|::: |.:|
  Fly   291 GICVNCKEGSTKPLADCTMYEICSGGKYVTKSCDSGYYWNSQSEVCDVD-NGQC 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 16/65 (25%)
CBM_14 156..198 CDD:279884 12/41 (29%)
CBM_14 272..321 CDD:279884 16/48 (33%)
CG17826NP_648528.1 CBM_14 36..74 CDD:279884
ChtBD2 <89..124 CDD:214696 13/34 (38%)
CBM_14 145..184 CDD:279884 12/58 (21%)
CBM_14 251..290 CDD:279884 7/43 (16%)
CBM_14 357..396 CDD:279884
CBM_14 463..502 CDD:279884
CBM_14 563..610 CDD:279884
CBM_14 621..670 CDD:279884
CBM_14 697..749 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472916
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.