DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and CG7252

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster


Alignment Length:298 Identity:59/298 - (19%)
Similarity:100/298 - (33%) Gaps:93/298 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CLGRQEGDLVPHPLDCNGYFSCS-RVPTLLYCDQGLQFDENRAICDLPENTNCRPVATGTVESAN 106
            |.|:::|.::..| :.||:|.|. :.|..:.|.:||:|:|...:||..::|. ..:.:..|:...
  Fly   251 CAGKRDGYMIADP-NSNGFFVCQCQCPIAMPCSEGLKFNETAQVCDWIKDTK-SAIGSSAVQCYG 313

  Fly   107 GLADNSELNWWPHKPKPVFVAVDVTSGQPVNPMEKYDPEHIEC---------RHYGAYFLPHPRN 162
            .|..|:.|:...:.                   |.|.|: :||         :..|..| |....
  Fly   314 DLVYNATLDQCDYP-------------------ENYVPK-VECNTTSTVCQNQPEGELF-PVEGK 357

  Fly   163 CGLYFICAYGHLHRHQCGRGTAWNFEKSECQLSDQAICYGESQISEPHTDVETTMKVPTANSEGA 227
            |.:::.|.:.......|.....:|....||:.....:|..|                        
  Fly   358 CNMFYKCNFNCAVEQYCPNNLVYNPNTEECEYPQDYVCPWE------------------------ 398

  Fly   228 VTVCYIVGSSEYTTLQQFLTSPEITELPPVTPPSPPRAEANALTCPST-------KQSYMSHPED 285
                                         .||||.|.|..:.:.|.|.       :.:|:....:
  Fly   399 -----------------------------YTPPSGPNAGPSGIACESNGRCMGQREGTYLKSTTN 434

  Fly   286 CSKYYICIGGMPVLTSCPKGLFWDQKSGFCEMEKNVKC 323
            ||.|.:|.....|...|..||:||:....|..:..|.|
  Fly   435 CSNYVVCQCECEVEMECADGLYWDESLQTCNYKNQVTC 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 17/51 (33%)
CBM_14 156..198 CDD:279884 8/41 (20%)
CBM_14 272..321 CDD:279884 14/55 (25%)
CG7252NP_648527.1 CBM_14 30..79 CDD:279884
CBM_14 175..226 CDD:279884
CBM_14 251..296 CDD:279884 15/45 (33%)
CBM_14 343..394 CDD:279884 9/51 (18%)
CBM_14 420..471 CDD:279884 12/50 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472919
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.