DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and CG5897

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001356901.1 Gene:CG5897 / 39346 FlyBaseID:FBgn0036220 Length:343 Species:Drosophila melanogaster


Alignment Length:189 Identity:39/189 - (20%)
Similarity:71/189 - (37%) Gaps:43/189 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 ECRHY-GAYFLPHPRNCGLYFICAYGHL-HRHQCGRGTAWNFEKSECQLSDQAICYGESQISEPH 210
            :|:.: |..::..|.:|..:..|....| .|..|..|..::|....|:.:...||:  ||:||..
  Fly    28 KCKLWAGTGYIGDPSDCQAWGYCQDNKLIDRRSCTEGLLYSFRDGTCKRASDTICH--SQLSEIC 90

  Fly   211 TDVE-----------------TTMKVPTANSEGAVTVCYIVGSSEYTTLQQFLTSPEITELPPVT 258
            ..:|                 ..:..||....|   |..:..:.:.|.|::....|:..      
  Fly    91 ASLEPWNYVANPADCRRFVKCADLDDPTWGDCG---VGQVFSNKKQTCLEEVAGCPQDN------ 146

  Fly   259 PPSPPRAEANALTCPSTKQ-SYMSHPEDCSKYYICIGGMPVLTSCPKGLFWDQKSGFCE 316
                        .|...|. |::..|:.|..||.|..|...:.:|..|.::::|:|.|:
  Fly   147 ------------ICSHMKDGSFVGDPKSCQIYYKCHNGFGTMLNCSVGRYFNRKTGNCQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884
CBM_14 156..198 CDD:279884 9/42 (21%)
CBM_14 272..321 CDD:279884 14/46 (30%)
CG5897NP_001356901.1 ChtBD2 146..192 CDD:214696 13/63 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444087
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.