DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and CG13312

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster


Alignment Length:224 Identity:45/224 - (20%)
Similarity:69/224 - (30%) Gaps:108/224 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 CAYGHLHRHQCGRGTAWNFEKSECQLSDQAIC------------YGESQISEPHTDVETTMKVPT 221
            ||.|::                 |.::|..||            |.:...:   |.|.:|....|
  Fly   127 CASGYV-----------------CNINDTQICGLPADGVMPTCSYSDDSTT---TTVSSTTSSTT 171

  Fly   222 A---NSEGAVTVC--------YIVGSSEYTTLQQFL--------------TSP------EITELP 255
            |   ::..|.|.|        |.||.:.|||.:|::              |.|      ..:|:.
  Fly   172 AAPPSTSSASTYCAAVQSQGKYAVGYNAYTTCRQYIYCTLVDGSWIGQTYTCPGSMYFDSASEMC 236

  Fly   256 PVTPPSPPRAEANALTCPSTKQS--------YMSHPE--------------------DCSKYYIC 292
            ..|.||         ||.:|..:        ..|:||                    .|.:|..|
  Fly   237 VSTMPS---------TCSTTATTSSTTTAAPTTSNPEAYCQAMQSAGYYPVGTDASTTCHQYIDC 292

  Fly   293 I------GGMPVLTSCPKGLFWDQKSGFC 315
            .      ||.  :.:||..|:::..|..|
  Fly   293 FLNGGTWGGN--MYTCPGSLYYNSASRTC 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884
CBM_14 156..198 CDD:279884 5/28 (18%)
CBM_14 272..321 CDD:279884 15/78 (19%)
CG13312NP_648260.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.