DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and CG32302

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:287 Identity:62/287 - (21%)
Similarity:98/287 - (34%) Gaps:84/287 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QEGDLVPHPLDCNGYFSCS--RVPTLLYCDQGLQFDENRAICDLP-ENTNCRPVATGTVESANGL 108
            |:..|.|.|.||..|..||  .|.|...|..|..:......|.|| |:..|       ::.....
  Fly    94 QQAGLFPDPYDCRRYHECSDQSVDTPRICSNGAGYSTLTGTCVLPRESEQC-------IQEQFTC 151

  Fly   109 ADNSELNWWPHKPKPVFVAVDVTSGQPVNPMEKYDPEHIECRHYGAYF-----LPHPRNCGLYFI 168
            :.:.::..|....:..:|.|:.|:       ....|..::| |.|..|     :|..|:     :
  Fly   152 SRSGQVGGWAPDNRYFYVCVNDTA-------NSLYPLMMKC-HEGFVFNSYSCVPDTRS-----M 203

  Fly   169 CAYGHLHRHQCGRGTAWNFEKSECQLSDQAICY-----GESQISEPHTDVETTMKVPTANSEGAV 228
            .:...:..|.|     .|.::.:|......|.|     ||.::          |..|..      
  Fly   204 RSIQAMESHTC-----MNNDRYQCPFRTSEIEYCKCVDGELEV----------MTCPAG------ 247

  Fly   229 TVCYIVGSSEYTTLQQFLTSPEITELPPVTPPSPPRAEANALTCP--STKQSYMSHPEDCSKYYI 291
                            |...|:|  |..||......::...|:||  |||..|      |    |
  Fly   248 ----------------FQIDPKI--LTCVTDRIYQCSDFEILSCPNVSTKDEY------C----I 284

  Fly   292 CIGGMPVLTSCPKGLFWDQKSGFCEME 318
            ||.....:.|||.|.:::.::..|:.|
  Fly   285 CIDHQLQIYSCPMGQYFNAETRKCQSE 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 17/49 (35%)
CBM_14 156..198 CDD:279884 7/46 (15%)
CBM_14 272..321 CDD:279884 16/49 (33%)
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 17/49 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444035
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.