DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and CG13806

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_647708.1 Gene:CG13806 / 38292 FlyBaseID:FBgn0035325 Length:297 Species:Drosophila melanogaster


Alignment Length:278 Identity:58/278 - (20%)
Similarity:97/278 - (34%) Gaps:78/278 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 ICDLPENTNCRPVATGTVESANGLADNSELNWWPHKPKPVFVAVDVTSGQPVN-----------P 138
            ||:     :|..:|| .|..:||         |.:.|   ..:.||.:|...|           |
  Fly    46 ICE-----SCELLAT-CVRHSNG---------WVNIP---VESCDVANGYYCNARLGSCTNETGP 92

  Fly   139 MEKYDPE-HIECRHYGAYFLPHPRNCGLYFICAYGH----LHRHQCGRGTAWNFEKSECQLS-DQ 197
            ...:..| :.:|...|.:  |.|.:|..|.:|.:..    .....||...|::....:|.|: ..
  Fly    93 CHPFGIEGNFQCTSQGIF--PDPYDCQKYHMCYFVGATLVAAAVDCGNDKAFDATTGQCTLTLTD 155

  Fly   198 AICYG------------------------ESQISEPHTDVETTMKVPTAN--SEGAVTVCYIVGS 236
            ::|..                        :|.:::...|  |.:..|:.:  ::|...|.|:..|
  Fly   156 SVCLQRQYYCPNAGHVAAWPTNPNIFYVCKSTVNQNLND--TIVIYPSLHRCNDGETFVDYVCRS 218

  Fly   237 SEYTTLQQFLTSPEITELPPVTPPSPPRAEANALTCPSTKQ--SYMSHPEDCSKYYIC--IGGMP 297
            .....       |..|:.|.|....|...:.:.|  |:|.|  ..|:...||.|||.|  :.|..
  Fly   219 GSNVL-------PPSTDDPSVIIEDPNDDDFSVL--PNTCQHVGLMADGNDCRKYYYCSALNGTL 274

  Fly   298 VLTSCPKGLFWDQKSGFC 315
            ....||.|.::..:...|
  Fly   275 RHMDCPNGTYYRPELSSC 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 2/8 (25%)
CBM_14 156..198 CDD:279884 10/46 (22%)
CBM_14 272..321 CDD:279884 15/48 (31%)
CG13806NP_647708.1 CBM_14 105..158 CDD:279884 11/54 (20%)
ChtBD2 247..293 CDD:214696 14/46 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443978
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.