DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and obst-E

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster


Alignment Length:271 Identity:60/271 - (22%)
Similarity:86/271 - (31%) Gaps:86/271 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 CNGYFSC-SRVPTLLYCDQGLQFDENRAICDLPENTNCRPVATGTVESANGLADNSELNWWPHKP 121
            |:.|..| ...|....|..||.|.:             |..|||....|                
  Fly    38 CDSYTECQDGTPVEKLCPDGLLFHQ-------------RTKATGECTYA---------------- 73

  Fly   122 KPVFVAVDVTSGQPVNPMEKYDPEHIEC-RHYGAYFLPHPRNCGLYFICAYGHLHRHQCGRGTAW 185
             |.....:....||.|..|       || |.:|.|.......||:|..||:|.....:|..|.|:
  Fly    74 -PYSTCKERARLQPANGTE-------ECPRQFGFYPNGDATKCGVYRNCAHGVASLTKCPEGLAF 130

  Fly   186 NFEKSECQLSDQA-ICYGESQISEPHTDVETTMKVPTANSEGAVTVCYIVGSSEYTTLQQFLTSP 249
            |.|..:|...|.. .|..|:.:.         ...|.|:|                         
  Fly   131 NEETYQCDWPDLVESCNAEAYLG---------FNCPAADS------------------------- 161

  Fly   250 EITELPPVTPPSPPRAEANALTCPSTKQSYMSHPEDCSKYYICIGGMPVLTSCPKGLFWDQKSGF 314
                       :...|.|.....|..:..|..||:.|.||::|:.|.|.|.:|.|.|.::.::..
  Fly   162 -----------ADDSAAAAVDVSPEGELRYYRHPQTCKKYFVCVNGHPRLYNCGKYLAFNSQTKL 215

  Fly   315 CEMEKNV-KCF 324
            |:....| :|:
  Fly   216 CDFYNKVPECY 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 8/36 (22%)
CBM_14 156..198 CDD:279884 13/41 (32%)
CBM_14 272..321 CDD:279884 15/48 (31%)
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 9/39 (23%)
CBM_14 95..146 CDD:307643 16/50 (32%)
CBM_14 180..225 CDD:307643 15/44 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.