DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and Peritrophin-A

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster


Alignment Length:322 Identity:70/322 - (21%)
Similarity:102/322 - (31%) Gaps:120/322 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CSWAYVLALSICFQLGAGHAVDQSWELPKVRHTVGHLSHICLGRQEGDLVPHPLDCNGYFSCSR- 66
            || ..:||...|     |||:           .||  |..|..:.......|..:|:.:|.|:. 
  Fly     7 CS-VLILAWIAC-----GHAL-----------AVG--SPECPEKYGVQAYAHTENCDQFFLCTNG 52

  Fly    67 VPTLLYCDQGLQFDENRAICDLPENTNCRPVATGTVESANGLADNSELNWWPHKPKPVFVAVDVT 131
            ..||..|:.||.||...|:     :.:|                  ..||          |||..
  Fly    53 TLTLETCENGLLFDGKGAV-----HNHC------------------NYNW----------AVDCK 84

  Fly   132 SGQPVNPMEKYDPEHIE---CRH-YGAYFLPHPRNCGLYFI-CAYGHLHRHQCGRGTAWNFEKSE 191
            ..|       :||..|.   |.: :|.|.:  .::|...:| ||:|..|...|..|.|::.....
  Fly    85 GRQ-------WDPTPISTPACEYQFGLYAV--SKDCSTTYIKCAHGEPHEQDCDAGLAYDERIHG 140

  Fly   192 CQLSDQAI--CYGESQISEPHTDVETTMKVPTANSEGAVTVCYIVGSSEYTTLQQFLTSPEITEL 254
            |...||.:  |..|:.:.         .|.||.....:|..             :|...|..   
  Fly   141 CNWPDQLLEHCNPEAVVG---------FKCPTKVDPNSVAA-------------RFWPFPRF--- 180

  Fly   255 PPVTPPSPPRAEANALTCPSTKQSYMSHPEDCSKYYICIGGMPVLTSCPKGLFWDQKSGFCE 316
             ||.                         .||.:...|:.|.|.|.||.:...:|:.:..||
  Fly   181 -PVA-------------------------GDCHRLITCVEGHPRLISCGEDKVFDEHTLTCE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 13/51 (25%)
CBM_14 156..198 CDD:279884 11/42 (26%)
CBM_14 272..321 CDD:279884 11/45 (24%)
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 17/79 (22%)
CBM_14 103..147 CDD:279884 13/45 (29%)
ChtBD2 179..218 CDD:214696 13/67 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.