DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and LOC3290701

DIOPT Version :10

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_061499387.1 Gene:LOC3290701 / 3290701 VectorBaseID:AGAMI1_010001 Length:263 Species:Anopheles gambiae


Alignment Length:89 Identity:19/89 - (21%)
Similarity:35/89 - (39%) Gaps:9/89 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DERVVAKNHDDSNYKLAKDNLLSKVNVFPRHICSINDTVSAEEAATE-------YEFAIRQMVRS 137
            |:|..|.:|:..:.|.|.|::  ..|....::.:......|:|:.||       .|...:::...
Mosquito   236 DKRDGAGSHNWGSVKEAIDDV--NKNESETNVTNAEGGAKADESGTEPQNEQATAEEEAKELTLD 298

  Fly   138 RTVAASDNSDSPRFDLILLGMGSD 161
            ...|.......|.|::...|.|.|
Mosquito   299 EWKAQQGQRIKPTFNIRKAGEGED 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..91 CDD:426342 4/10 (40%)
CBM_14 156..198 CDD:426342 3/6 (50%)
CBM_14 272..321 CDD:426342
LOC3290701XP_061499387.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.