DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and Cht6

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster


Alignment Length:400 Identity:80/400 - (20%)
Similarity:137/400 - (34%) Gaps:107/400 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LALSICFQLGAGHAVDQSWELPKVRHTVG---------HLSHICLGRQEGDLVPH-PLDCNGYFS 63
            |.|::....|..: :|:.:::||:...:.         |.||      |..:..| ||......|
  Fly   191 LLLTMAVPAGIEY-IDKGYDVPKLNKYLDWFNVLTYDFHSSH------EPSVNHHAPLYSLEEDS 248

  Fly    64 CSRVPTLLYCDQGLQF------DENRAICDLP-----------ENTNCRPVATGTVESANGLADN 111
            .......|..|..:::      |.::.:..:|           |:|.....|.|..|..:...:.
  Fly   249 EYNYDAELNIDYSIKYYLKAGADRDKLVLGIPTYGRSYTLINEESTELGAPAEGPGEQGDATREK 313

  Fly   112 SELNWW----PHKPKPVFVAVDVTSGQP-----------VNPMEKYDPEHIECRHYGAYFLPHPR 161
            ..|.::    ..|..|.:..|     ||           .|....||.|.| .|....|.:....
  Fly   314 GYLAYYEICQTLKDDPEWTVV-----QPNANVMGPYAYRRNQWVGYDDEAI-VRKKAEYVVAQGL 372

  Fly   162 NCGLYFICAYGHLHRHQCGRGTAWNFEKSECQLSDQAICYGESQISEP----------------- 209
            . |:.|........|..| .|..:...::..:...:|:..|.:::::|                 
  Fly   373 G-GIMFWAIDNDDFRGTC-NGKPYPLIEAAKEAMVEALGLGINEVAKPSGPQKPSRSRSRDNASN 435

  Fly   210 ------HTDVETTMKVPTANSEGAVTVCYIVGSSEYTTLQQFLTSPEITEL----------PPVT 258
                  .|:...:.:.|:|....||:.......|  ||.:  ||..|.:.|          ||.|
  Fly   436 RNRLNGKTEAPLSSRRPSATRRPAVSSTQAPPPS--TTFK--LTEAEGSSLYIGGRASTTPPPPT 496

  Fly   259 PPSPPRAEANALTCPSTKQSYMSHPEDCSKYYICIGGMPV-------LTSCPKGLFWDQKSGFCE 316
            .|.|    .:...|  .::.:..||.||.|||.|:...|.       :.:||.||:::..:..|:
  Fly   497 TPDP----GSDFKC--EEEGFFQHPRDCKKYYWCLDSGPSGLGIVAHMFTCPSGLYFNPAADSCD 555

  Fly   317 MEKNVKCFQK 326
            ..:||.|..|
  Fly   556 FARNVPCKTK 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 11/68 (16%)
CBM_14 156..198 CDD:279884 5/41 (12%)
CBM_14 272..321 CDD:279884 15/55 (27%)
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 38/205 (19%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 41/227 (18%)
CBM_14 506..562 CDD:279884 17/57 (30%)
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.