DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment obst-F and Muc96D

DIOPT Version :9

Sequence 1:	NP_649186.1	Gene:	obst-F / 40209	FlyBaseID:	FBgn0036947	Length:	326	Species:	Drosophila melanogaster
Sequence 2:	NP_733106.2	Gene:	Muc96D / 318737	FlyBaseID:	FBgn0051439	Length:	881	Species:	Drosophila melanogaster

Alignment Length:	52	Identity:	21/52 - (40%)
Similarity:	28/52 - (53%)	Gaps:	0/52 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    43 CLGRQEGDLVPHPLDCNGYFSCSRVPTLLYCDQGLQFDENRAICDLPENTNC 94
            |||:.:|.|:..|..||.|:.|.....|........|:..:.||||||||:|
  Fly   827 CLGKPDGFLMASPERCNDYYICRHQRALKVSCGDRYFNGLKGICDLPENTSC 878

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
obst-F	NP_649186.1	CBM_14	43..94	CDD:279884	20/50 (40%)
		CBM_14	156..198	CDD:279884
		CBM_14	272..321	CDD:279884
Muc96D	NP_733106.2	ChtBD2	29..72	CDD:214696
Muc96D	NP_733106.2	CBM_14	827..875	CDD:279884	17/47 (36%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0016697
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.000