DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and CG33263

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_996072.1 Gene:CG33263 / 2768952 FlyBaseID:FBgn0053263 Length:227 Species:Drosophila melanogaster


Alignment Length:191 Identity:50/191 - (26%)
Similarity:76/191 - (39%) Gaps:37/191 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 NCGLYFICAYGHLHRHQCGRGTAWNFEKSECQLSDQAICYGESQ------------ISEPHTDVE 214
            :|..|..|......|..|...|.::....||...|:.:|...|.            ..|..:.:|
  Fly    42 DCASYIYCNGEDSFRDSCPESTYFDDRTQECAFDDEGVCLRNSDSVQTEEQPDKQTTGEEQSGIE 106

  Fly   215 TTMKVPTANSEGAVTVCYIVGSSEYTTLQQFLTS------PEITELPPVT--PPSPPRAEANALT 271
            .|..|||..|:.|.|     ||::.:|.|...|:      |.:|| ||.|  .||.|.|:.::  
  Fly   107 ETTPVPTPPSDYAST-----GSADSSTFQADSTTTPTESIPSVTE-PPTTSATPSSPSAKPSS-- 163

  Fly   272 CPSTKQSYMS--------HPEDCSKYYICIGGMPVLTSCPKGLFWDQKSGFCEMEKNVKCF 324
             |:.::.:..        ||:.|..||.|:.|...:..||....||..:..|:.....:||
  Fly   164 -PAQERPHCDISGDGDHPHPQRCEYYYRCLSGYLTIVRCPYKYGWDFPTKQCKPSSEAQCF 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884
CBM_14 156..198 CDD:279884 9/35 (26%)
CBM_14 272..321 CDD:279884 13/56 (23%)
CG33263NP_996072.1 CBM_14 28..79 CDD:279884 9/36 (25%)
CBM_14 171..222 CDD:279884 12/50 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.