DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and C39D10.7

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_509334.3 Gene:C39D10.7 / 181050 WormBaseID:WBGene00016534 Length:1171 Species:Caenorhabditis elegans


Alignment Length:300 Identity:63/300 - (21%)
Similarity:108/300 - (36%) Gaps:69/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ICLGRQEGDLVPHPLDCNGY-FSCSRVPTLLY-CDQGLQFDENRAICDLPENTNCRPVATGTVES 104
            :|..|.:|:   :..||..| ..|....|..: |..||.:...:..||:.||....|....|.::
 Worm   674 MCAKRDDGN---YGFDCEKYLIKCYNRKTFKFPCPSGLYYSRLQDKCDVKENVEGCPEYKPTTDA 735

  Fly   105 ANGLADNSELNWWPHKPKPVFVAVDVTSGQPVNPMEKYDP-------------EHIECRHYGAYF 156
            .            |...:||....:.  |...:..:.|:|             |.:|..:||.  
 Worm   736 T------------PAAEQPVISYQNY--GYSQSTTKAYNPSVTTPSPQHAAFCERLENGNYGL-- 784

  Fly   157 LPHPRNCGLYFI-CAYGHLHRHQCGRGTAWNFEKSECQLSDQA-IC--YGESQISEPHTDVETTM 217
                 :|..|:| |.......::|..|..::...:.|...:.. .|  |..:..:.|..:...|.
 Worm   785 -----DCEDYYISCNNFETTINRCPAGLFYSKLNNRCDYKEHVEDCPEYKPTPSTTPAAEQPGTT 844

  Fly   218 KVPTANSEGAVTVCYIVGSSEYTTLQQFLTSPEITELPPVTPPSPPRAEANALTCPSTKQSYMSH 282
            |..|.|               |..:....|:|...:..|:         |.|.:|........:.
 Worm   845 KYTTYN---------------YPNIDYTSTTPGPVDTTPL---------AKAFSCSGRPDGIYAL 885

  Fly   283 PEDCSKYYI-CIGGMPVLTSCPKGLFWDQKSGFCEMEKNV 321
            |. ||:.|: |:.|..:::||..|||:::|:|.|..:..|
 Worm   886 PY-CSQDYVQCMQGRSLISSCAPGLFYNEKNGMCAYKHTV 924

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 15/52 (29%)
CBM_14 156..198 CDD:279884 7/42 (17%)
CBM_14 272..321 CDD:279884 15/49 (31%)
C39D10.7NP_509334.3 CBM_14 29..79 CDD:279884
CBM_14 98..148 CDD:279884
CBM_14 189..242 CDD:279884
ChtBD2 337..384 CDD:214696
CBM_14 419..467 CDD:279884
CBM_14 560..612 CDD:279884
CBM_14 675..726 CDD:279884 15/53 (28%)
CBM_14 774..825 CDD:279884 11/57 (19%)
CBM_14 875..927 CDD:279884 15/50 (30%)
CBM_14 941..992 CDD:279884
CBM_14 1010..1062 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.