DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and R02F2.4

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_498171.1 Gene:R02F2.4 / 175755 WormBaseID:WBGene00019833 Length:431 Species:Caenorhabditis elegans


Alignment Length:281 Identity:56/281 - (19%)
Similarity:90/281 - (32%) Gaps:98/281 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QCSWAYVLALSICFQLGAGHAVDQSWELPKVRHTVGHLSHICLGRQEG---------DLVPHP-- 55
            :|||..:  :..|.|: :|...:....:.|     ...|::.....||         :||.:|  
 Worm   161 KCSWKGM--IDECSQV-SGEYCESDGNISK-----SECSNVFFSCSEGIAHRRNCPANLVFNPAI 217

  Fly    56 ---------LDC-------------NGYFSCSR-----------VPTLLYCDQGLQFDENRAICD 87
                     :||             :||||..|           :|.:::|..||.|.|...:||
 Worm   218 SSCDWPKNVMDCSEKSEKPQNCGEVDGYFSFGRCSSSFSACTNGIPIVMFCPDGLMFSEKNQMCD 282

  Fly    88 LPENTN-CRPVATGTVES-------------ANGL-----------ADNSELNWWPHKPKPVFVA 127
            ...|.: |...::|.:|:             .|||           ..|...|.:...|..||..
 Worm   283 YEWNVDECDLESSGFMENYKASEALTPCTNMDNGLYALDCTPRVLSCQNGRENIFECPPSLVFNE 347

  Fly   128 VDVTSGQPVNPME--KYDPEHIECRHYGAYFLPHPRNCGL------------YFICAYGHLHRHQ 178
            ..:....|...::  ..|...|.....|.|      :|.:            |..|:.|.|..|:
 Worm   348 NSLICDYPETSLKCCMEDALLIRDASIGTY------DCSIDGLFSSTLCSRNYHKCSNGQLIPHE 406

  Fly   179 CGRGTAWNFEKSECQLSDQAI 199
            |....| .|..|..:..|.::
 Worm   407 CADSNA-VFSASAAKCVDSSL 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 21/95 (22%)
CBM_14 156..198 CDD:279884 11/53 (21%)
CBM_14 272..321 CDD:279884
R02F2.4NP_498171.1 CBM_14 25..74 CDD:279884
ChtBD2 117..165 CDD:214696 2/3 (67%)
CBM_14 185..229 CDD:279884 7/48 (15%)
ChtBD2 240..283 CDD:214696 12/42 (29%)
CBM_14 310..361 CDD:279884 9/50 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.