DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and LOC108179232

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_021322084.1 Gene:LOC108179232 / 108179232 -ID:- Length:185 Species:Danio rerio


Alignment Length:183 Identity:39/183 - (21%)
Similarity:60/183 - (32%) Gaps:47/183 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 FICAYGHLHRHQ--CGRGTAW-----NFEKSECQLSDQAICYGESQISEPHTDVETTMKVPTANS 224
            :.|..|..|.|:  |..|| |     :...|.|.|.........|.:.:|              |
Zfish     3 YYCPAGTRHPHEFPCPPGT-WSNALGSKSVSSCWLCPAGFYCNSSGLIQP--------------S 52

  Fly   225 EGAVTVCYIVGSSEYTTLQQFLTSPEITELPPVTPPSPPRAEANALTCPSTKQSYMSHPEDCS-- 287
            .......|..|.::.......||.   ...|  |....|:..|:.|.||....|..:...:||  
Zfish    53 GNCAPGFYCAGGAKTAMPDDGLTG---NRCP--TRYYCPQGCASPLHCPDGTHSNSTGSAECSDC 112

  Fly   288 ----------------KYYICIGG-MPVLTSCPKGLFWDQKSGFCEMEKNVKC 323
                            |.:.|:|| :..:..||.|.: ..|:|..::|:.:.|
Zfish   113 PTGWLCLEGEDLQLCPKGHYCVGGTVEDILPCPPGTY-SPKAGQSQVEQCLLC 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884
CBM_14 156..198 CDD:279884 11/37 (30%)
CBM_14 272..321 CDD:279884 15/67 (22%)
LOC108179232XP_021322084.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.