DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-F and CG42728

DIOPT Version :9

Sequence 1:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001189111.1 Gene:CG42728 / 10178859 FlyBaseID:FBgn0261681 Length:156 Species:Drosophila melanogaster


Alignment Length:140 Identity:34/140 - (24%)
Similarity:56/140 - (40%) Gaps:19/140 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 QC-GRGTAWNFEKSECQLSDQAICYGESQISEPHTDVETTMKVPTANSEGAVTVCYIVGSSEYTT 241
            :| |:....|..:|.|..| ...|.|::.:.  .||..|.         .|...|..:...:.:|
  Fly    30 ECSGQNGFINNTRSNCNYS-LINCSGQNSMF--CTDNTTC---------NANFTCSDILPVDNST 82

  Fly   242 LQQFLTSPE-ITELPPVTPPSPPRAEANALTCPSTKQSYMSHPEDCSKYYICIGGMPVLTSCPKG 305
            .....|:|. :|.......||..|.|     |........|:|::|:.:|.|:.|..::..||.|
  Fly    83 ALPISTTPNVVTTASTTVSPSDIRRE-----CRQGVTKRFSYPQNCNYFYYCVDGFLLVEQCPIG 142

  Fly   306 LFWDQKSGFC 315
            ..:|.::|.|
  Fly   143 YAFDPQTGAC 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-FNP_649186.1 CBM_14 43..94 CDD:279884
CBM_14 156..198 CDD:279884 6/20 (30%)
CBM_14 272..321 CDD:279884 13/44 (30%)
CG42728NP_001189111.1 CBM_14 117..152 CDD:279884 11/34 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.